Next Article in Journal
The Growing Complexity of Cancer Cell Response to DNA-Damaging Agents: Caspase 3 Mediates Cell Death or Survival?
Next Article in Special Issue
Antibacterial Activity of Ciprofloxacin-Encapsulated Cockle Shells Calcium Carbonate (Aragonite) Nanoparticles and Its Biocompatability in Macrophage J774A.1
Previous Article in Journal
Rapid Diminution in the Level and Activity of DNA-Dependent Protein Kinase in Cancer Cells by a Reactive Nitro-Benzoxadiazole Compound
Previous Article in Special Issue
pH-Responsive Hyaluronic Acid-Based Mixed Micelles for the Hepatoma-Targeting Delivery of Doxorubicin
 
 
Search for Articles:
Title / Keyword
Author / Affiliation / Email
Journal
Article Type
 
 
Advanced Search
 
Section
Special Issue
Volume
Issue
Number
Page
 
Journals
IJMS
Volume 17
Issue 5
10.3390/ijms17050701
ijms-logo
Submit to this Journal Review for this Journal Propose a Special Issue
► Article Menu

Article Menu

share Share announcement Help format_quote Cite question_answer Discuss in SciProfiles thumb_up
...
Endorse textsms
...
Comment
first_page
settings
Order Article Reprints
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Review

Design and Application of Antimicrobial Peptide Conjugates

by
Andre Reinhardt
and
Ines Neundorf
*
Department of Chemistry, Institute of Biochemistry, University of Cologne, Zuelpicher Str. 47, D-50674 Cologne, Germany
*
Author to whom correspondence should be addressed.
Int. J. Mol. Sci. 2016, 17(5), 701; https://doi.org/10.3390/ijms17050701
Submission received: 15 March 2016 / Revised: 25 April 2016 / Accepted: 4 May 2016 / Published: 11 May 2016
(This article belongs to the Special Issue Drug Delivery and Antimicrobial Agents)
Versions Notes

Abstract

:
Antimicrobial peptides (AMPs) are an interesting class of antibiotics characterized by their unique antibiotic activity and lower propensity for developing resistance compared to common antibiotics. They belong to the class of membrane-active peptides and usually act selectively against bacteria, fungi and protozoans. AMPs, but also peptide conjugates containing AMPs, have come more and more into the focus of research during the last few years. Within this article, recent work on AMP conjugates is reviewed. Different aspects will be highlighted as a combination of AMPs with antibiotics or organometallic compounds aiming to increase antibacterial activity or target selectivity, conjugation with photosensitizers for improving photodynamic therapy (PDT) or the attachment to particles, to name only a few. Owing to the enormous resonance of antimicrobial conjugates in the literature so far, this research topic seems to be very attractive to different scientific fields, like medicine, biology, biochemistry or chemistry.

1. Introduction

Growing antibiotic resistance has become a major health problem [1,2,3] and has encouraged many researchers to find alternative antibiotic classes. In this context, antimicrobial peptides (AMPs) have emerged as promising new agents to combat pathogens. AMPs are essential polypeptides in host defense and play an important role in the innate immune system [4,5,6,7]. They act against a diverse spectrum of organisms, such as Gram-positive and Gram-negative bacteria, as well as fungi, parasites and viruses [4,8,9]. AMPs exhibit a unique mode of action that is mainly related to their cationic amphipathic properties, making them capable of permeabilizing microbial membranes [4,5,8]. Accordingly, AMPs have come more and more into focus of research, although with the first clinical use of AMPs, the development of AMP-resistant strains is inevitable and intensively investigated [10,11].

1.1. Antimicrobial Peptides (AMPs): Classification

Antimicrobial peptides are highly diverse molecules, which can be divided into four groups based on structural characteristics: α-helical, β-sheet, extended and loop peptides [4,6,8]. Most AMPs share an amphipathic character with a net positive charge and a high content (around 50%) of hydrophobic residues. Magainin, LL-37 and cecropin [12,13] are examples of such AMPs that belong to the group of amphipathic α-helical peptides. The structure of β-sheet- or β-strand-like AMPs, including the defensin family and protegrin, is characterized by the presence of two or more disulfide bridges that stabilize their conformation [6]. Extended AMPs often contain a high percentage of proline, tryptophan, arginine and histidine residues in their primary sequence. In most cases, these peptides form only irregular secondary structures. Well-known representatives are indolicidin and bactenecins [14,15]. The smallest group of AMPs is the highly stable peptides exhibiting a hairpin-like loop structure that is interconnected by at least one disulfide bridge [16]. Examples include dodecapeptide [17] and tachyplesins [18].
During the last few years, many efforts have been made in the identification and development of synthetic AMPs [7,19]. The rationale is to shorten the size and thereby to optimize metabolic stability, bioavailability and issues regarding safety and immunogenicity. In addition, shorter sequences would dramatically decrease production costs. For instance, a detailed study about the critical length of cationic AMPs still exhibiting antimicrobial activity had been reported by Strom et al. some years ago [20]. Increased levels of activity might be also possible after the introduction of unnatural amino acids and replacement or modification of the peptide bond within the AMP sequence [21]. This review will also include some AMP conjugates composed of such designed AMPs.

1.2. AMPs: Mechanism of Action

Owing to their cationic nature, AMPs are attracted to the negative charges at the outer microbial membrane, supporting highly-selective interaction. Bacterial surfaces are characterized by their negative environment that is caused by the presence of negative compounds, such as lipoteichoic acid and lipopolysaccharides [22,23]. Compared to this, mammalian surfaces differ in their composition, containing zwitterionic phospholipids, sphingomyelin and cholesterol, which allows AMPs to selectively target microbial membranes [24]. However, the toxicity of AMPs against eukaryotic cells is an important issue and has to be investigated to realize future clinical applications [25,26,27]. For instance, the modulation of the physicochemical parameters, like hydrophobicity, net charge and helicity, might be a promising strategy [28] and has been investigated in several recent studies [29,30,31,32].
Usually, AMPs adopt well-defined secondary structures when they come into contact with the membranes of pathogens. After this initial step of binding by electrostatic forces, membrane permeabilization takes place, where bacterial membranes finally get disrupted [33]. This induces several processes, e.g., the breakdown of the membrane potential and the leakage of intracellular components, leading to subsequent cell death. The underlying membrane-disrupting mechanisms are highly complex and will be only briefly introduced. In particular, many different models have been suggested, including the toroidal-pore model, the barrel-stave model and the carpet-like model [34]. In the toroidal-pore model, the peptides aggregate on the membrane surface and induce the membrane to bend continuously through the pore, leading to a pore built up by the inserted peptides, as well as by the lipid head groups [6,35]. It is emphasized that the peptides, although being already inserted in the membrane, are continuously in association with phospholipid head groups [36]. In contrast, within the barrel-stave model, the attached peptides aggregate at the outer membrane first and, as a result, insert into the cell membrane [37,38]. Hereby, the hydrophilic peptide regions form the interior region of the core, and the hydrophobic part is oriented to the lipids of the cell membrane [36,39]. Lastly, the carpet-like model is characterized by the absence of such a pore formation. Peptides accumulate parallel to the bacterial membrane, covering the whole membrane surface in a carpet-like manner [40,41]. In the next step, the surface-attached peptides induce permeabilization, and the membrane is disrupted in a detergent-like manner, finally leading to the particular formation of micelles [42,43,44].
Although for most AMPs, membrane permeabilization processes are described, they can also act by using other mechanisms. After entering pathogenic cells, these AMPs reach intracellular targets, leading to the inhibition of cell-wall synthesis [45], inactivation of relevant enzymes [46,47,48] or affect DNA, RNA and protein synthesis [49,50,51,52].

2. Modified AMPs and AMP Conjugates

AMPs as a novel class of antimicrobial therapeutics give hope to confining the rise of antibiotic resistances and to acting as promising novel weapons against microbial pathogens. Moreover, since they are able to interact in some cases with human cell membranes, as well, AMPs can be used as delivery vectors for several bioactive compounds [53]. However, despite all of the benefits that have emerged with the development of AMPs, researchers aim to face several shortcomings and to enhance their antibacterial activity and mode of action by various modifications, leading to functionalized AMPs and AMP conjugates. The potential of such new AMP compositions, which include AMP mimetics, hybrid AMPs, AMP congeners, stabilized AMPs, immobilized AMPs and AMP conjugates, was recently summarized by Brogden et al. [54].
In fact, AMPs can be functionalized to generate peptide conjugates, in which various substances are attached by different coupling strategies. Very common is to fuse the modification at the α amino group of the N-terminal end with a carboxyl group to yield an amide bond. This can be done in many cases when the peptide is still attached to the solid support employing standard reagents that are used in solid phase peptide synthesis (SPPS). However, when the conjugate is generated in solution with the free peptide, chemoselective coupling methods have to be used, including activation by amino reactive N-hydroxysuccinimides (NHS), or thiol reactive maleimide groups, as well as copper(I)-catalyzed alkyne-azide cycloaddition (CuAAC), and many others. Within this work, we try to review recent advances in the generation and application of such AMP conjugates together with their interesting novel and modulated activities (Table 1).

2.1. Antibiotics Coupled to AMPs and AMP-Like Sequences

One strategy of AMP modulation is the covalent coupling of antibiotics to induce synergistic antibacterial effects. Such a combination therapy is supposed to increase antibacterial activity and to decrease administration dose, thus lowering the risk for adverse side effects. For example, vancomycin was coupled via CuAAC reaction to several peptide variants based on the magainin 2 sequence [76]. The authors tested the interaction with model membranes, bacterial growth inhibition and activity against eukaryotic membranes. Interestingly, an increase of antimicrobial activity of vancomycin-magainin conjugates was only visible against vancomycin-resistant Enterococci, where they determined minimal inhibitory concentration (MIC) values in the range or even better as for vancomycin alone. Besides, their results allowed concluding that the length of the peptide sequence had an influence on the mode of action with the bacterial membrane. Shorter peptides below 20 amino acids seemed to interplay via a carpet-like mechanism, while longer peptides preferably interacted by forming transmembrane pores. This observation was in agreement with former studies [42]. However, although the strategy seemed very promising since the conjugates showed no dramatic hemolytic effect, additive effects of both compounds in combination have not been tested yet.
Ghaffar et al. conjugated the broad spectrum antibiotic levofloxacin with the highly hydrophobic antimicrobial peptide indolicidin [65,91]. Coupling between both components was achieved via amide bond formation or a labile ester linkage to investigate whether a prodrug-type linkage would have any impact on activity. Although activity was still present, it could not be increased compared to the substances alone. Moreover, the activity was not dependent on the chosen linkage. Notably, the authors studied also the coupling to a cell-penetrating peptide (Tat48-59), but also in this case, no enhanced activity could be detected. Finally, the physical mixture of levofloxacin and indolicidin showed slightly improved antibacterial activity in comparison to levofloxacin and indolicidin alone [65], proving that covalent linkage had diminished the activity of levofloxacin.
Just recently, Chen et al. reported about a ubiquicidin (UBI) variant coupled to the typical antibiotic chloramphenicol (CAP) [86]. UBI is a cationic peptide that showed antibacterial activity towards Staphylococcus aureus [92]. UBI29-41 was used as a bacterial targeting sequence and demonstrated selective targeting capability against several bacteria (Escherichia coli, S. aureus, P. aeruginosa), as well as in bacteria-infected mouse models. Conjugation of CAP to the N-terminal of UBI29-41 was realized through the linker glutaraldehyde. The CAP-UBI29-41 conjugate showed enhanced activity in E. coli and S. aureus. Moreover, the toxicity against human cells was decreased compared to CAP alone. Most importantly, efficient targeting and bacterial killing was observed when analyzing the in vivo mouse model.
In several studies, it has been demonstrated that short peptide motifs can have a positive effect on the antibacterial activity of antibiotic drugs. For instance, Bera et al. developed a lysine-modified neomycin B variant to produce novel polycationic lysine mimetics that should increase antibacterial activity and simultaneously mediate higher binding affinity to RNA [90]. Neomycin B was chemically manipulated by taking advantage of the presence of a single OH-group at the C5′′-position. Thus, coupling of a short Tryp-Tryp-Lys-motif was possible. Recent studies, where neomycin was modified at this C5′′-position, have already proven that conjugates with interesting new antimicrobial activities can be obtained by this strategy [93,94,95]. Additionally, the neomycin B conjugates designed by Bera et al. demonstrated improved activity against resistant bacteria, such as methicillin-resistant S. epidermidis (MRSE) and gentamicin-resistant E. coli. Furthermore, it was hypothesized that attachment of amphiphilic amino acids might change the mode of action of neomycin B [90].
In another context, neomycin was modified with small dehydropeptides to yield amphiphilic nanostructures with a hydrophobic core and a hydrophilic surface [88]. The aim of the study was to design multifunctional amphiphilic conjugates capable of interacting with pDNA and the cell membrane, respectively. Besides using these conjugates as pDNA delivery vehicles, an application as novel antimicrobial agents seemed feasible. It was emphasized that the hydrophobic inner core and cationic outer surface of peptide-neomycin nanostructures would result in better electrostatic interaction with the bacterial membranes and that this might lead to an increased antimicrobial activity, as well. In this case, the activated peptide chain was introduced at the amino groups of neomycin. Indeed, characterization of the novel amphipathic peptide-neomycin conjugates proved that the hydrophilic outer surface of the nanostructures interacts specifically with bacterial membranes. With MIC values in the range of 8–9 μg/mL against Gram-positive bacteria, the novel peptide-neomycin nanostructures are highly versatile multifunctional carriers [88].
Taken together, these investigations exemplify that beside the positive effects, covalent coupling of antibiotics might diminish antibacterial activity. On the other hand, whenever the physical mixture of antibiotic and AMP was tested, an enhanced biological effect was determined. Accordingly, combination therapy itself is still very attractive, but the generation and activity of covalent conjugates has to be carefully explored in every case. For this, possible coupling sites within the structures of the investigated antibiotics should be identified to lower the risk of decreasing antibiotic efficiency after attachment to an AMP. Furthermore, novel ligation strategies should be tested, including also self-immolative linkers that liberate their cargo at the active site after a certain stimulus.

2.2. Improving AMP Activity by Lipidation

One other possibility of enhancing the activity of AMPs is to improve their interaction with the bacterial surface/membrane. Chu-Kung et al. reported about fatty acid-modified AMPs that were tested in terms of antibacterial activity and interaction with model membranes [56]. Fatty acids of different lengths (C12-C20) were introduced at the N-terminal end of AKK- and LKK-motif AMPs. The results indicated that the length of the fatty acid that can be introduced is limited, since too long acyl chains increased aggregation and self-assembly of the conjugates. However, conjugates, including C14-C18 long fatty acids, dramatically improved MIC values for several bacterial strains tested. It was concluded that linkage to fatty acids can promote the ability to form secondary structures when in contact with bacterial membranes [56,96].
The arginine/tryptophan containing peptide RWRWRW, named also MP196 [20], was modified with lipids of different lengths either at the N- or C-terminal end of the peptide [80]. Thus, an additional lysine residue was introduced N- or C-terminally, respectively, and the acyl chain was coupled to the ε-amino group of this lysine. Using this approach, assessment of both the length and attachment side of the lipid chain regarding bacterial and hemolytic activity was possible. Among all conjugates tested, a lipidated variant with a C8-acyl chain turned out to be the most effective. Interestingly, whereas the coupling site had no significant influence on the bacterial activity, hemolytic effects were strongly influenced. C-terminal lipidation was not that harmful, probably due to the fact that N-terminal lipidation combined with the positive charge of the N-terminus increased faster and more efficient hemolysis. In further studies, these C8-conjugates were investigated in more detail regarding their mode of action [97]. Particularly, the authors highlight in depth proteome profiling studies of the influence of the MP196 conjugates on the biological response of B. subtilis. Thereby, they could demonstrate for the first time that lipidation of MP196 does not change the mode of action considerably.
Recently, Arnusch et al. reported about the lipophilic modification of AMPs with the aim to narrow their mode of action and to direct their activity against fungi [89]. Lipopeptides form a class of peptides with a strong membrane affinity and, thus, broad activity spectrum. In this work, mimics of lipopeptides were generated by N-terminal coupling of different lipophilic groups, e.g., cholesterol, biotin or vitamin E, to short AMP sequences. Especially, vitamin E and cholesterol bioconjugates showed high and selective activities against the fungal strains tested, including Aspergillus, Candida and two more other species [89]. Then, cyclodextrin (CD) and amphotericin B (AmB) were tested for synergistic effects, whereby the addition of AmB led to a fungal inhibition concentration of 0.37 μM in C. albicans. However, the addition of CD did modulate the selectivity, particularly for the vitamin E-peptide conjugate. Summarizing, biologically-active lipopeptides with high membrane selectivity could be designed by this approach.

2.3. Photosensitizer-AMP Conjugates

Photodynamic therapy (PDT) uses a photosensitizer (PS) that, after exposure to a particular type of light, produces reactive oxygen species (ROS) that damage proteins, nucleic acids and lipids [98,99] and lead to cell death. PDT is particularly effective at killing resistant bacteria strains [98,100,101], whereas Gram-positive bacteria are more affected than Gram-negative bacteria, owing to their additional outer membrane [102,103,104]. Based on these observations, a combination of photosensitizers with AMPs was investigated by several groups to study additive biological effects. Johnson et al. tested whether amphiphilic AMPs conjugated to a PS bind and kill Gram-positive, as well as primary Gram-negative bacteria [66]. To reach this goal, the PS eosin Y was coupled as 5,6-carboxy eosin Y to the N-terminal of the AMP KLA (KLAKLAK)2. Both compounds showed no antibacterial effect when tested alone; however, in the presence of 1 μM of the conjugate, 99% of the tested bacteria were killed. Furthermore, conjugation of (KLAKLAK)2 to eosin Y enhances binding to bacteria 10-fold. Of note is that only 10% hemolysis was obtained, demonstrating that the photolytic activity is more pronounced towards bacteria than to eukaryotic cells. Altogether, these results highlighted eosin-(KLAKLAK)2 as a promising new lead compound for bacterial treatment. In further experiments, the additive effects of eosin and the AMP were elucidated in more detail [67]. It was found out that the PS-peptide was localized at Gram-negative and Gram-positive bacterial membranes, respectively, and upon irradiation, the eosin-(KLAKLAK)2 conjugate was capable of destroying Gram-positive, as well as Gram-negative bacterial membrane components. Based on these results, it was reasoned that the (KLAKLAK)2 part acts as a targeting agent to bacterial membranes and disrupts the membrane by oxidation of lipids or that the lytic activity of oxidized lipids is amplified by the AMP component [67].
Porphyrins are another group of photosensitizers that were coupled to AMPs. It has been documented that neutral PS kill Gram-positive bacteria, but do not kill Gram-negative bacteria [105,106,107]. Doselli et al. tested in 2010 a porphyrin-apidaecin conjugate [55]. Also in this study, attachment of the PS took place at the N-terminus of the AMP. Notably, when performing toxicity studies in the dark, the conjugate completely lost its antibacterial activity. Contrarily, the compounds alone were still active. This observation probably suggests that the size of porphyrin prevented the uptake of the conjugate inside the bacteria cells. Interestingly, the light-activated conjugate was able to kill bacteria and exhibited high antibacterial activity, especially against E. coli and S. aureus [55].
Liu and co-workers reported effective photodynamic therapy by using a conjugate consisting of protoporphyrin (PpIX) coupled to two units of a lipopolysaccharide binding AMP to selectively adhere to the surface of Gram-negative bacteria. In this study, the authors activated PpIX with a maleimide group for selective coupling with the sulfhydryl group of a cysteine of the AMP, named YI13WF. Subsequently, they used this conjugate for specific imaging and photodynamic inactivation of Gram-negative bacteria [87], and their results proved the successful delivery of the photosensitizer to the bacterial surface. In addition, four- to eight-fold lower MIC values of the PpIX-peptide conjugate compared to the peptide and PpIX alone were obtained. Still, PpIX-peptide conjugates demonstrated selective targeting against bacterial strains only, since no activity against mammalian cells was detected [87].
All PS-AMP conjugates discussed herein exhibited increased activities compared to the parent compounds alone. AMPs were mostly used to provoke selective binding to the pathogens, while by the attached PS, the production of ROS was induced. All in all, the combination of PS with AMPs seems to be a highly promising approach to improve antibacterial activity and to widen the overall activity spectrum of such compounds.

2.4. Decoration of Particles and Polymers with AMPs

Nano-/micro-particles can be produced out of a large variety of materials, resulting in different shapes, sizes and surfaces. During the last few years, one main field of research was their development and application as drug delivery vehicles [108]. Furthermore, attachment to particles can be used to avoid any dissemination of AMPs to the environment. For instance, paramagnetic silica microparticles were surface-modified by magainin-I [75]. The particles were functionalized by a hydrophilic polymer brush, and the AMP was grafted via a heterofunctional linker to the hydroxyl groups on the surface. In this way, multifunctional particles exhibiting antibacterial and magnetic properties could be obtained. Such conjugates might be interesting for the disinfection of aqueous solutions, but also for in vivo applications due to the possibility of directing them by magnetic fields to a localized antibacterial action.
Coating of surfaces with AMPs aiming to reduce or prevent the formation of biofilms infection is also a growing field of interest, particularly in the biomedical field [38]. Usually, hard surfaces made of glass or titanium are decorated with AMPs in an often multi-step synthesis, starting with surface functionalization by appropriate linkers, followed by conjugation of the AMPs. Many of such routes have been described; however, the details are out of the scope of this review. Despite the attachment of the AMPs directly onto the surface, Rai et al. recently reported about AMP-decorated gold (Au) nanoparticles that were coated on glass slides [59]. There, the Au-particles were functionalized with a maleimide linker to which the thiol group of a cecropin-melittin AMP was attached. The AMP-Au particles were then coated on glass surfaces, and bacterial activity against E. coli and S. aureus was tested. The authors report high activity against both strains tested, which was presumably due to a higher coating density compared to other studies reported so far. Importantly, the antibacterial activity of the surface immobilized AMP was more effective in long-term exposure compared to the free AMP. Additionally, no toxicity against human cells was detected.
To minimize or reduce microbial contamination on polymer surfaces, AMPs can be directly introduced onto the polymer scaffold by covalent coupling. Recently, Kim et al. reported about AMPs immobilized on PEG-resin [70]. They used an antibacterial β-sheet peptide and an α-helical peptide that were both immobilized on PEG-PS resin. Both conjugates were tested against bacterial strains, but only the β-sheet peptide containing resin exhibited antibacterial activity. Again, the activity could be increased by the addition of common antibiotics like vancomycin or tetracycline, respectively, proving their approach as a powerful strategy to enhance antibacterial activity. Since such surface immobilization of AMPs might be critical due to the effect on the secondary structure during the immobilization process, Gao et al. investigated the membrane interaction of surface-tethered AMP IDR-1010cys [64]. IDR-1010cys, short-chain antimicrobial and immunomodulatory peptide innate defense regulator (IDR) 1010, was immobilized via maleimide linkage to functionalized quartz slides. Several physical parameters were determined; importantly, the influence of immobilization on the secondary structure, as well as the ability to interact with model membranes was elucidated. Compared to the free peptide in solution, their results allowed concluding that biological activity is extremely dependent on the surface density of the peptides. In addition, the chosen linkage between the AMP and the surface can have a profound impact and should be selected carefully. This observation holds true also for other studies where AMP immobilization was investigated [109,110].
Knowledge about the mechanism of action of AMPs is indispensable for future development. Especially, in vitro measurements do not necessarily correlate with the in vivo activity of antimicrobial peptides. Recently, a novel fluorescent live bacteria lysis assay was developed by Leptihn et al. [83]. In this study, the process of antibacterial action was monitored on the single-molecule level. Sushi I, an α-helical cationic AMP that targets Gram-negative bacteria, was coupled at the N-terminal to biotin and coated on streptavidin-modified quantum dots. Analyzing those quantum dot-Sushi I conjugates, it could be shown that they bind to the bacterial surface and migrate over the membrane surface. Increased concentrations led to decreased movement of the peptide, indicating a multimeric association of Sushi I and the formation of membrane-active peptide complexes. Additionally, membrane lysis was proven by single particle tracking and bacterial cell lysis assays. Furthermore, the authors generated nanogold-Sushi I conjugates that were inspected using transmission electron microscopy (TEM). Their observations indicated that sushi I binds to the outer and inner membrane of E. coli bacteria, leading finally to the leakage of cytosolic content [83]. Although such studies allow the dissemination of AMP molecular mechanisms, it has to be proven accurately how the results can be transferred to other structurally-similar AMPs.
Despite these more specific examples, recent efforts on AMP-nanoparticle combinations have been made in the context of clinical development of AMPs with the aim to lower cytotoxicity, increase proteolytic stability and improve antimicrobial activity. Thus, nanoscale particles have been used to include AMPs in novel formulations [111].

2.5. Conjugates out of AMPs and Organometallic Complexes

During the last few years, the introduction of organometallic groups in biomolecules, like peptides, proteins or nucleic acids, has come more and more into the focus of research. The metal center can cause novel functionalities and reactivities to the new compounds, and among them are also substances showing promising effects against multidrug-resistant bacteria [112]. For example, ferrocene (Fc) is one of these compounds for which it is known that it can enhance the pharmacodynamic profiles of bioactive molecules [113]. Recently, Fc was combined with the AMP MP66 [114], a small peptide fragment that was derived from the protein lactotransferrin [79]. Ferrocene was coupled via amide bond formation to the N-terminal of MP66. It was shown that treatment of C. glutamicum with the ferrocene-MP66 conjugate causes cellular stress. Furthermore, a specific cell response related to the Fc moiety was detected that was expressed in an upregulation of cell-wall synthesis proteins and downregulation of permeases and porins. Additionally, the lipid composition of the cell was drastically altered. The herein reported approach gave for the first time access to metal-conjugated peptide antibiotics with membrane-targeting properties [79].
Recently, Pal et al. reported about a multifunctional non-covalent complex including antimicrobial, as well as wound healing activity. It consisted of a bi-valent silver polydiguanide complex including histatin-1 [62], an AMP that was identified to be involved in re-epithelialization processes [115]. The synthesis of the metal complex-containing peptide conjugate was achieved by complexation between a silver chlorhexidine complex and the peptide. The combination of both compounds demonstrated promising MIC values (around 1 mg/L) against a wide spectrum of bacteria and, furthermore, was identified as a wound healing-promoting agent. In the future, such combinations might be useful for the treatment of infected wounds [62].
In recent years, biosensors played an important role in pathogenic bacteria detection. Yongxin et al. used a ferrocene-peptide conjugate to develop a novel metal-containing biosensor [74]. Owing to its favorable electrochemical properties, Fc and derivatives have been often used in electrochemical systems. The surface of the electrode was functionalized with an NHS linker to couple the ferrocene derivative that contained two carboxyl groups, via an amide bond. Magainin I, for which an enhanced selectivity of bacterial recognition has been already reported [116], was coupled to the remaining carboxyl group of Fc. The resultant ferrocene-magainin conjugate was then used to detect E. coli cells. Notably, the ferrocene-magainin biosensor induced a 10-fold increased detection limit of E. coli compared to label-free biosensors, making this approach promising for future bacterial detection.
In another study, selective labeling of tryptophan residues by organometallic ruthenium complexes was used to elucidate the biodistribution of the AMP melittin in mice [78]. Melittin is a component of bee venom and has attracted much attention owing to its antibacterial and anticancer activity [117]. Complexation of melittin with the commercially-available ruthenium complex [(C5H5)Ru(naphthalene)]+ in aqueous solution and in air gave the organometallic derivative of melittin, in which ruthenium was coordinated via a tryptophan residue of the peptide. The ruthenium-containing label showed high chemical stability and had no influence on the secondary structure of the peptide. However, in vivo tracking of the ruthenium-labeled AMP was possible, and the labeling changed the intramolecular interactions of the AMP in that it had reduced hemolysis activity [78].

2.6. AMPs and AMP Containing Conjugates as Anti-Cancer Drugs

Recently, it has been recognized that cationic antimicrobial peptides can serve as novel drugs with cancer-selective activity. Cancer cells are characterized by a higher content of anionic phospholipids, such as phosphatidylserine, at the outer leaflet, making them attractive targets for the mainly positively-charged AMPs. After binding, they can generate physical holes causing leakage of the cell content and, finally, cell death [118]. To further improve their selectivity and to reduce side effects to healthy cells, Rivero-Mueller et al. generated a peptide conjugate composed of an AMP and a cancer-targeting peptide [60]. Such hybrid peptides including a targeting domain and a cell-killing domain are usually obtained by direct chemical peptide synthesis or as fusion protein expressed in a recombinant system. In this study, hecate, an analogue to the bee venom main component melittin, was chemically fused with the 81–95 amino acid fragment of the chorionic gonadotropin-β (CGβ) subunit. This CGβ subunit is known to target cells expressing the luteinizing hormone receptor (LHR), even at very low doses or when LHR is expressed at low levels [60]. Testing the hecate-CGβ conjugate in mouse xenografts and transgenic mouse models proved its efficiency in destroying LHR-expressing cancer cells. The mechanism of action was the destruction of the cell membrane after binding to the LHR-expressing cells leading to cell necrosis with only minimal side effects. In a similar study, the reactivity of magainin II was directed against cancer cells by fusion to bombesin that targets selectively receptors overexpressed on various kinds of cancer cells [77]. The fusion peptide was investigated in vitro and in vivo and demonstrated promising anticancer activity.
Furthermore, for the peptide buforin IIb cancer-targeting specificity was enhanced, in this case by fusion to a matrix metalloproteinase (MMP)-selective cleavage site. MMPs are zinc-dependent endopeptidases, and many cancer types have shown increased expression levels of MMPs. Furthermore, buforin was masked by an anionic peptide to decrease side effects deriving from the cationic charges of buforin [58]. Indeed, the conjugate showed improved effects compared to buforin alone when different cancer cells were treated.
Recently, hecate was modified with gallic acid, and the activity against cancer and non-cancer cells was tested [61]. Gallic acid was introduced at the N-terminal by standard solid phase peptide chemistry. Interestingly, although the α helical content of the secondary structure was reduced after introducing gallic acid to hecate, activity against erythrocytes was increased. The authors discussed this with the increased hydrophobicity and hydrophobic moment that was already shown to enhance the lysis of erythrocytes [119].
In this context, Zhong et al. reported about a polyvalent lytic peptide-polymer conjugate that was designed to overcome the problem of multidrug resistance. The lytic hexapeptide KWKWKW, or KW3, was coupled to dextran in several copies via CuAAC chemistry. The resultant KW3-dextran conjugates showed 500-fold increased anticancer potency compared to the hexapeptide alone and even promising effects in multidrug-resistant cancer cells. Again, no hemolytic activity was observed [71]. It was reasoned that their high potency against cancer cells was caused by the polyvalent structure that increased the local concentration of the membrane-active peptide.
One other peptide for which first antimicrobial activity and later on also anticancer activity have been reported is the amphipathic peptide KLA ([KLAKLAK]2) that destabilizes the mitochondrial membrane potential and triggers the apoptotic cell death program [120]. Meanwhile, several examples of hybrid peptides have been described where KLA as the proapoptotic domain was coupled to other carrier peptides, like cell-penetrating or tumor-homing peptides [81,121,122]. Moreover, in 2003, Jiang et al. conjugated the protein transduction domain PTD-5 to KLA with the aim to produce a pro-apoptotic peptide (named DP1), which should selectively disrupt both mitochondrial and bacterial membranes [68]. PTD-5 has been reported to be very efficient in internalization into cells [123]. Western blots of mitochondrial and cytosolic fractions indicated cytochrome c (cyt c) release from mitochondria after treatment with DP1. Additionally, the release led to enhanced H2O2 production and to selective oxidation of phosphatidylserine in the inner leaflet of the plasma membrane during apoptosis. Collectively, the cyt c release plays an important role in selective catalysis of phosphatidylserine oxidation. Finally, DP1 induced phosphatidylserine externalization and enhanced phagocytosis of treated cells by macrophages [68]. In another study, KLA was conjugated to octaarginine or to the hydrophobic PFVYLI peptide, in both cases to improve the delivery of KLA inside cells. A cellular localization assay demonstrated that PFVYLI is internalized in cells in a temperature-dependent way by endocytosis. When using this peptide as a transporter for KLA, a significant influence on cell viability was detected. Although the uptake mechanism remained undetermined, it seemed to be different than for the octaarginine compound [69].
Soler et al. investigated the ability of several AMP variants to act as delivery vehicles for the cytostatic drug chlorambucil [57]. A set of peptides selected from a library of cecropin-melittin hybrids (CECMEL11), previously designed to be used in plant protection, was screened for their cytotoxicity against diverse cancer cell lines. The best peptide exhibiting no effects on cell viability was BP16, which was then tested for its ability to transport chlorambucil inside cells. The drug was covalently coupled by amide bond formation at the N-terminal of BP16, and its activity against several cancer cell lines was elucidated. It could be shown that attachment to BP16 dramatically increased the cytotoxicity of this drug between six- and nine-fold. Additionally, when in conjugation with the homing peptide CREKA, BP16 was able to improve the cytotoxic activity of chlorambucil from two- to 4.5-fold, demonstrating again the positive affect of such a coupling.
In our group, we developed a branched peptide variant of the peptide sC18, a short C-terminal fragment of the 18-kD antimicrobial protein CAP18 [124,125]. This branched dimer of sC18, namely (sC18)2, was used as a drug delivery vector for chlorambucil or KLA, respectively [81]. In both cases, we introduced a cathepsin B cleavage site between the cargo and the peptide carrier. Cathepsin B is a protease that is overexpressed in many tumor cells and, thus, allows one to promote selective cargo release at the target site [126,127]. We could demonstrate that (sC18)2 was an efficient transporter and that it exhibited certain selectivity against cancer cells, which we attributed to its increased content of hydrophilic residues compared to the parent peptide sC18. Thus, improved interaction with the anionic membranes of cancer cells is possible [81].

2.7. Other Examples of Modulated AMPs

Using CuAAC reaction coumarin, a benzopyrone with antimicrobial, anti-inflammatory and anticancer properties was conjugated to UBI [128]. The combination of both parts displayed antimicrobial activity within a concentration range of 0.04–0.18 mM. Furthermore, it was not toxic to human cells above 0.21 mM [84]. The same peptide was used in another context to develop a hybrid tracer useful for SPECT and optical imaging of bacterial infections [85]. Welling et al. modified UBI both with a Cy5 dye and a DTPA chelator useful to complex the radioisotope 111In. The hybrid label was introduced when the peptide still resided in the solid phase, and the resultant hybrid conjugate was tested in vitro and in vivo. Notably, the used peptide had superior properties for binding multiple bacteria and, therefore, serves as an excellent imaging and detection agent.
In a previous work, we investigated the influence of imidazolium cations on the activity of AMPs [72,73]. Based on observations that imidazolium cations, as part of so-called ionic liquids [73,129], exhibit antimicrobial activity, these compounds were covalently and non-covalently added to AMPs. AMPs used for coupling were sC18 [125] and the LL-37 peptide, which also belongs to the group of cathelicidins and is a two-amino acid truncated form of FALL-39 [13,130]. The imidazolium salts were coupled to the α- and ε-amino groups of lysine residues that were N-terminally elongated to the peptide. The resultant compounds exhibited high antimicrobial activity (around 1 µM) against different Gram-positive and Gram-negative bacterial strains and even against multidrug-resistant strains, like MRSA and VRE. Notably, non-covalent mixtures were not as efficient as the covalently-bridged constructs. Furthermore, one short AMP-IL-conjugate, IL-KKA, was identified that also showed promising selectivity towards bacterial membranes compared to eukaryotic ones [72,73].
Another modification to improve bacterial selectivity and activity was the coupling of sheep myeloid antimicrobial peptide (SMAP) 28 to affinity- and protein G-purified rabbit immunoglobulin G (IgG) antibodies specific to the outer surface of Porphyromonas gingivalis strain 381 [82]. The linkage between both moieties was performed by using a chemoselective cross-linking reaction between maleimide that was attached to SMAP 28 and the sulfhydryl groups of the antibody. Franzmann and co-workers could demonstrate that the selectivity of the antibody-AMP conjugate was concentration dependent and that the best results were obtained when concentrations of 20 µg protein/mL were applied. Thus, they developed a highly potent and selective conjugate against P. gingivalis.
In another study, Tati et al. investigated spermidine-AMP conjugates to function as inhibitors against oral Candida strains. Spermidine was linked to an active fragment of histatin 5 that belongs to the histatins, a family of histidine-rich cationic peptides secreted by human parotid and submandibular-sublingual salivary glands with selective antifungal activity and little or no bactericidal activity [63]. Two different variants were generated, one having the spermidine unit at the N-terminal, the other at the C-terminal end. The authors reported that topical treatment of oral candidiasis with the His-spermidine conjugate was highly effective. In particular, doses well below those of the control fluconazole could be applied. Interestingly, placement of spermidine had a profound impact on activity, since the conjugate bearing spermidine at the C-terminal end was significantly more active.
Other applications of AMPs include their use as escaping peptides for endocytosis-mediated drug delivery. In these cases AMPs are often fused to CPPs, and functionalized with the respective cargo. For instance, Salomone et al. combined the cell-penetrating peptide TAT11 with the AMP hybrid CM18 (derived from cecropin A and melittin) and investigated its drug delivery properties. Improved endosomal drug release was observed by using this strategy [131]. Moreover, using a conjugate composed of the designed AMP, C(LLKK)3C, fused to the TAT peptide and stearic acid, delivery of nucleic acids was determined. Promising transfection efficiencies were observed, leading to the conclusion that the conjugate was efficiently released out of the endosomes by its capacity to lyse the endosomal membranes [132].

3. Concluding Remarks

Overuse of common antibiotic drugs in hospitals, but also in industrial farming, has provoked the emergence of multidrug-resistant organisms. To efficiently combat these pathogens, finding novel classes of antibiotics has become a major global concern and has been pushed forward over the last few years. Within this field of research, antimicrobial peptides have become key players as promising new alternative therapeutics. Beside their application as natural sequences, many efforts were made in the generation of AMP conjugates to create compounds with novel activity spectra. Looking back on the last few years, many new groups of conjugates have been identified, and interesting new molecules have been designed, not only with the rationale to enhance the efficiency against bacterial pathogens, but also to use AMPs as, e.g., anticancer drugs. Regarding the forthcoming improvements in synthesis strategies to lower production costs, such AMP conjugates might be relevant future solutions with high potential.

Acknowledgments

Ines Neundorf thanks the University of Cologne for funding within the 2nd and 3rd Female Scientists Program.

Conflicts of Interest

The authors declare no conflict of interest.

Abbreviations

3T3Mouse fibroblast cells
AmBAmphotericin B
AMPAntimicrobial peptide
B16-F0Mouse skin melanoma cells
BacBacitracin
BLT-1Murine Leydig tumor cells
CAPChloramphenicol
CAPAN-1Human pancreatic adenocarcinoma cells
CBAMouse kidney cells
CDCyclodextrin
CuAACCopper(1)-catalyzed alkyne-azide cycloaddition
Cyt cCytochrome c
DTPADiethylene triamine pentaacetic acid
DU-145Human prostate carcinoma cells
DX5Antibody that reacts with CD49b integrin
FcFerrocene
FSFHuman facial skin fibroblast cells
GE11-β3Mouse mammary epithelial cells
HT-1080Human fibrosarcoma cells
IDRImmunmodulatory peptide innate defense regulator
IgGImmunglobuline
ILIonic liquid
KG1aHuman bone marrow macrophages
KLAProapoptotic domain peptide (KLAKLAK)2
LPSLipopolysaccharide
MBPMaltose binding protein
MCA-205Murine fibrosarcoma cells
MCF-7Michigan Cancer Foundation-7, breast cancer cell line
MES-SAHuman uterine epithelial cells
MICMinimal inhibitory concentration
MMPMatrix metallo-proteinase
MRSAMethicillin-resistant S. aureus
MRSEMethicilin-resistant S. epidermidis
NDHFNormal human dermal fibroblast cells
NHSN-hydroxysuccinimide
pDNAPlasmid desoxyribonucleic acid
PDTPhotodynamic therapy
PEG-PSPolyethylene glycol-polystyrene
PNAPeptide nucleic acid
PpIXProtoprophyrin IX
PSPhotosensitizer
RNARibonucleic acid
ROSReactive oxygen species
SCOVHuman ovary adenocarcinoma cells
SDS PAGESodium dodecyl sulfate polyacrylamide gel electrophoresis
SMAPSheep myeloid antimicrobial peptide
SPECTSingle-photon emission computer tomography
SPPSSolid phase peptide synthesis
TEMTransmission electron microscopy
U87 MGHuman glioblastoma cells
UBIUbiquicidin
VREVancomycin-resistant Enterococci
ZR-75-30Human breast ductual carcinoma cells

References

  1. Marr, A.K.; Gooderham, W.J.; Hancock, R.E.W. Antibacterial peptides for therapeutic use: Obstacles and realistic outlook. Curr. Opin. Pharmacol. 2006, 6, 468–472. [Google Scholar] [CrossRef] [PubMed]
  2. Mygind, P.H.; Fischer, R.L.; Schnorr, K.M.; Hansen, M.T.; Sonksen, C.P.; Ludvigsen, S.; Raventos, D.; Buskov, S.; Christensen, B.; de Maria, L.; et al. Plectasin is a peptide antibiotic with therapeutic potential from a saprophytic fungus. Nature 2005, 437, 975–980. [Google Scholar] [CrossRef] [PubMed]
  3. Hof, W.V.T.; Veerman, E.C.I.; Helmerhorst, E.J.; Amerongen, A.V.N. Antimicrobial peptides: Properties and applicability. Biol. Chem. 2001, 382, 597–619. [Google Scholar] [CrossRef] [PubMed]
  4. Zasloff, M. Antimicrobial peptides of multicellular organisms. Nature 2002, 415, 389–395. [Google Scholar] [CrossRef] [PubMed]
  5. Hancock, R.E.W.; Sahl, H.G. Antimicrobial and host-defense peptides as new anti-infective therapeutic strategies. Nat. Biotechnol. 2006, 24, 1551–1557. [Google Scholar] [CrossRef] [PubMed]
  6. Nguyen, L.T.; Haney, E.F.; Vogel, H.J. The expanding scope of antimicrobial peptide structures and their modes of action. Trends Biotechnol. 2011, 29, 464–472. [Google Scholar] [CrossRef] [PubMed]
  7. Fjell, C.D.; Hiss, J.A.; Hancock, R.E.W.; Schneider, G. Designing antimicrobial peptides: Form follows function. Nat. Rev. Drug Discov. 2012, 11, 37–51. [Google Scholar] [CrossRef]
  8. Hancock, R.E.W.; Lehrer, R. Cationic peptides: A new source of antibiotics. Trends Biotechnol. 1998, 16, 82–88. [Google Scholar] [CrossRef]
  9. Brogden, K.A.; Ackermann, M.; McCray, P.B.; Tack, B.F. Antimicrobial peptides in animals and their role in host defences. Int. J. Antimicrob. Agents 2003, 22, 465–478. [Google Scholar] [CrossRef]
  10. Maria-Neto, S.; de Almeida, K.C.; Macedo, M.L.R.; Franco, O.L. Understanding bacterial resistance to antimicrobial peptides: From the surface to deep inside. Biochim. Biophys. Acta Biomembr. 2015, 1848, 3078–3088. [Google Scholar] [CrossRef] [PubMed]
  11. Ghosh, C.; Haldar, J. Membrane-active small molecules: Designs inspired by antimicrobial peptides. Chemmedchem 2015, 10, 1606–1624. [Google Scholar] [CrossRef] [PubMed]
  12. Andersson, M.; Boman, A.; Boman, H.G. Ascaris nematodes from pig and human make three antibacterial peptides: Isolation of cecropin p1 and two asabf peptides. Cell. Mol. Life Sci. 2003, 60, 599–606. [Google Scholar] [CrossRef] [PubMed]
  13. Agerberth, B.; Gunne, H.; Odeberg, J.; Kogner, P.; Boman, H.G.; Gudmundsson, G.H. Fall-39, a putative human peptide antibiotic, is cysteine-free and expressed in bone-marrow and testis. Proc. Natl. Acad. Sci. USA 1995, 92, 195–199. [Google Scholar] [CrossRef] [PubMed]
  14. Falla, T.J.; Karunaratne, D.N.; Hancock, R.E.W. Mode of action of the antimicrobial peptide indolicidin. J. Biol. Chem. 1996, 271, 19298–19303. [Google Scholar] [CrossRef] [PubMed]
  15. Frank, R.W.; Gennaro, R.; Schneider, K.; Przybylski, M.; Romeo, D. Amino-acid-sequences of 2 proline-rich bactenecins—Antimicrobial peptides of bovine neutrophils. J. Biol. Chem. 1990, 265, 18871–18874. [Google Scholar] [PubMed]
  16. Wu, M.H.; Hancock, R.E.W. Interaction of the cyclic antimicrobial cationic peptide bactenecin with the outer and cytoplasmic membrane. J. Biol. Chem. 1999, 274, 29–35. [Google Scholar] [CrossRef] [PubMed]
  17. Dings, R.P.M.; Haseman, J.R.; Leslie, D.B.; Luong, M.; Dunn, D.L.; Mayo, K.H. Bacterial membrane disrupting dodecapeptide SC4 improves survival of mice challenged with Pseudomonas aeruginosa. BBA-Gen. Subj. 2013, 1830, 3454–3457. [Google Scholar] [CrossRef] [PubMed]
  18. Xu, F.; Meng, K.; Wang, Y.R.; Lu, H.Y.; Yang, P.L.; Wu, N.F.; Fan, Y.L.; Yao, B. Eukaryotic expression and antimicrobial spectrum determination of the peptide tachyplesin II. Protein Expr. Purif. 2008, 58, 175–183. [Google Scholar] [CrossRef] [PubMed]
  19. Findlay, B.; Zhanel, G.G.; Schweizer, F. Cationic amphiphiles, a new generation of antimicrobials inspired by the natural antimicrobial peptide scaffold. Antimicrob. Agents Chemother. 2010, 54, 4049–4058. [Google Scholar] [CrossRef] [PubMed]
  20. Strom, M.B.; Haug, B.E.; Skar, M.L.; Stensen, W.; Stiberg, T.; Svendsen, J.S. The pharmacophore of short cationic antibacterial peptides. J. Med. Chem. 2003, 46, 1567–1570. [Google Scholar] [CrossRef] [PubMed]
  21. Thaker, H.D.; Sgolastra, F.; Clements, D.; Scott, R.W.; Tew, G.N. Synthetic mimics of antimicrobial peptides from triaryl scaffolds. J. Med. Chem. 2011, 54, 2241–2254. [Google Scholar] [CrossRef] [PubMed]
  22. Scott, M.G.; Yan, H.; Hancock, R.E.W. Biological properties of structurally related α-helical cationic antimicrobial peptides. Infect. Immun. 1999, 67, 2005–2009. [Google Scholar] [PubMed]
  23. Scott, M.G.; Gold, M.R.; Hancock, R.E.W. Interaction of cationic peptides with lipoteichoic acid and Gram-positive bacteria. Infect. Immun. 1999, 67, 6445–6453. [Google Scholar] [PubMed]
  24. Matsuzaki, K. Why and how are peptide-lipid interactions utilized for self-defense? Magainins and tachyplesins as archetypes. BBA-Biomembranes 1999, 1462, 1–10. [Google Scholar] [CrossRef]
  25. Pag, U.; Oedenkoven, M.; Papo, N.; Oren, Z.; Shai, Y.; Sahl, H.G. In vitro activity and mode of action of diastereomeric antimicrobial peptides against bacterial clinical isolates. J. Antimicrob. Chemother. 2004, 53, 230–239. [Google Scholar] [CrossRef] [PubMed]
  26. Wang, P.; Bang, J.K.; Kim, H.J.; Kim, J.K.; Kim, Y.; Shin, S.Y. Antimicrobial specificity and mechanism of action of disulfide-removed linear analogs of the plant-derived Cys-rich antimicrobial peptide Ib-AMP1. Peptides 2009, 30, 2144–2149. [Google Scholar] [CrossRef] [PubMed]
  27. Huang, J.F.; Xu, Y.M.; Hao, D.M.; Huang, Y.B.; Liu, Y.; Chen, Y.X. Structure-guided de novo design of α-helical antimicrobial peptide with enhanced specificity. Pure Appl. Chem. 2010, 82, 243–257. [Google Scholar] [CrossRef]
  28. Huang, Y.B.; He, L.Y.; Li, G.R.; Zhai, N.C.; Jiang, H.Y.; Chen, Y.X. Role of helicity of α-helical antimicrobial peptides to improve specificity. Protein Cell 2014, 5, 631–642. [Google Scholar] [CrossRef] [PubMed]
  29. Oren, Z.; Shai, Y. Selective lysis of bacteria but not mammalian cells by diastereomers of melittin: Structure-function study. Biochemistry 1997, 36, 1826–1835. [Google Scholar] [CrossRef] [PubMed]
  30. Zhu, W.L.; Nan, Y.H.; Hahm, K.S.; Shin, S.Y. Cell selectivity of an antimicrobial peptide melittin diastereomer with D-amino acid in the leucine zipper sequence. J. Biochem. Mol. Biol. 2007, 40, 1090–1094. [Google Scholar] [CrossRef] [PubMed]
  31. Oren, Z.; Shai, Y. Cyclization of a non cell-selective cytolytic amphipatic α-helical peptide renders it selective to bacteria. Biophys. J. 2000, 78, 14a. [Google Scholar]
  32. Song, Y.M.; Park, Y.; Lim, S.S.; Yang, S.T.; Woo, E.R.; Park, I.S.; Lee, J.S.; Kim, J.I.; Hahm, K.S.; Kim, Y.; et al. Cell selectivity and mechanism of action of antimicrobial model peptides containing peptoid residues. Biochemistry 2005, 44, 12094–12106. [Google Scholar] [CrossRef] [PubMed]
  33. Da Costa, J.P.; Cova, M.; Ferreira, R.; Vitorino, R. Antimicrobial peptides: An alternative for innovative medicines? Appl. Microbiol. Biotechnol. 2015, 99, 2023–2040. [Google Scholar] [CrossRef] [PubMed]
  34. Brogden, K.A. Antimicrobial peptides: Pore formers or metabolic inhibitors in bacteria? Nat. Rev. Microbiol. 2005, 3, 238–250. [Google Scholar] [CrossRef] [PubMed]
  35. Matsuzaki, K.; Murase, O.; Fujii, N.; Miyajima, K. An antimicrobial peptide, magainin 2, induced rapid flip-flop of phospholipids coupled with pore formation and peptide translocation. Biochemistry 1996, 35, 11361–11368. [Google Scholar] [CrossRef] [PubMed]
  36. Yang, L.; Harroun, T.A.; Weiss, T.M.; Ding, L.; Huang, H.W. Barrel-stave model or toroidal model? A case study on melittin pores. Biophys. J. 2001, 81, 1475–1485. [Google Scholar] [CrossRef]
  37. Kang, S.J.; Park, S.J.; Mishig-Ochir, T.; Lee, B.J. Antimicrobial peptides: Therapeutic potentials. Expert Rev. Anti-Infect. Ther. 2014, 12, 1477–1486. [Google Scholar] [CrossRef] [PubMed]
  38. Di Luca, M.; Maccari, G.; Nifosi, R. Treatment of microbial biofilms in the post-antibiotic era: Prophylactic and therapeutic use of antimicrobial peptides and their design by bioinformatics tools. Pathog. Dis. 2014, 70, 257–270. [Google Scholar] [CrossRef] [PubMed]
  39. Ehrenstein, G.; Lecar, H. Electrically gated ionic channels in lipid bilayers. Q. Rev. Biophys. 1977, 10, 1–34. [Google Scholar] [CrossRef] [PubMed]
  40. Bechinger, B. The structure, dynamics and orientation of antimicrobial peptides in membranes by multidimensional solid-state nmr spectroscopy. BBA-Biomembranes 1999, 1462, 157–183. [Google Scholar] [CrossRef]
  41. Pouny, Y.; Rapaport, D.; Mor, A.; Nicolas, P.; Shai, Y. Interaction of antimicrobial dermaseptin and its fluorescently labeled analogs with phospholipid-membranes. Biochemistry 1992, 31, 12416–12423. [Google Scholar] [CrossRef] [PubMed]
  42. Shai, Y. Mechanism of the binding, insertion and destabilization of phospholipid bilayer membranes by α-helical antimicrobial and cell non-selective membrane-lytic peptides. BBA-Biomembranes 1999, 1462, 55–70. [Google Scholar] [CrossRef]
  43. Ladokhin, A.S.; White, S.H. “Detergent-like” permeabilization of anionic lipid vesicles by melittin. BBA-Biomembranes 2001, 1514, 253–260. [Google Scholar] [CrossRef]
  44. Fernandez, D.I.; Le Brun, A.P.; Whitwell, T.C.; Sani, M.A.; James, M.; Separovic, F. The antimicrobial peptide aurein 1.2 disrupts model membranes via the carpet mechanism. Phys. Chem. Chem. Phys. 2012, 14, 15739–15751. [Google Scholar] [CrossRef] [PubMed]
  45. Brotz, H.; Bierbaum, G.; Leopold, K.; Reynolds, P.E.; Sahl, H.G. The lantibiotic mersacidin inhibits peptidoglycan synthesis by targeting lipid ii. Antimicrob. Agents Chemother. 1998, 42, 154–160. [Google Scholar] [PubMed]
  46. Kavanagh, K.; Dowd, S. Histatins: Antimicrobial peptides with therapeutic potential. J. Pharm. Pharmacol. 2004, 56, 285–289. [Google Scholar] [CrossRef] [PubMed]
  47. Andreu, D.; Rivas, L. Animal antimicrobial peptides: An overview. Biopolymers 1998, 47, 415–433. [Google Scholar] [CrossRef]
  48. Kragol, G.; Lovas, S.; Varadi, G.; Condie, B.A.; Hoffmann, R.; Otvos, L. The antibacterial peptide pyrrhocoricin inhibits the atpase actions of dnak and prevents chaperone-assisted protein folding. Biochemistry 2001, 40, 3016–3026. [Google Scholar] [CrossRef] [PubMed]
  49. Lehrer, R.I.; Barton, A.; Daher, K.A.; Harwig, S.S.L.; Ganz, T.; Selsted, M.E. Interaction of human defensins with Escherichia-coli—Mechanism of bactericidal activity. J. Clin. Investig. 1989, 84, 553–561. [Google Scholar] [CrossRef] [PubMed]
  50. Boman, H.G.; Agerberth, B.; Boman, A. Mechanisms of action on Escherichia coli of cecropin-P1 and PR-39, 2 antibacterial peptides from pig intestine. Infect. Immun. 1993, 61, 2978–2984. [Google Scholar] [PubMed]
  51. Subbalakshmi, C.; Sitaram, N. Mechanism of antimicrobial action of indolicidin. FEMS Microbiol. Lett. 1998, 160, 91–96. [Google Scholar] [CrossRef] [PubMed]
  52. Patrzykat, A.; Friedrich, C.L.; Zhang, L.J.; Mendoza, V.; Hancock, R.E.W. Sublethal concentrations of pleurocidin-derived antimicrobial peptides inhibit macromolecular synthesis in Escherichia coli. Antimicrob. Agents Chemother. 2002, 46, 605–614. [Google Scholar] [CrossRef] [PubMed]
  53. Splith, K.; Neundorf, I. Antimicrobial peptides with cell-penetrating peptide properties and vice versa. Eur. Biophys. J. Biophys. 2011, 40, 387–397. [Google Scholar] [CrossRef] [PubMed]
  54. Brogden, N.K.; Brogden, K.A. Will new generations of modified antimicrobial peptides improve their potential as pharmaceuticals? Int. J. Antimicrob. Agents 2011, 38, 217–225. [Google Scholar] [CrossRef] [PubMed]
  55. Dosselli, R.; Gobbo, M.; Bolognini, E.; Campestrini, S.; Reddi, E. Porphyrin—Apidaecin conjugate as a new broad spectrum antibacterial agent. ACS Med. Chem. Lett. 2010, 1, 35–38. [Google Scholar] [CrossRef] [PubMed]
  56. Chu-Kung, A.F.; Nguyen, R.; Bozzelli, K.N.; Tirrell, M. Chain length dependence of antimicrobial peptide-fatty acid conjugate activity. J. Colloid Interface Sci. 2010, 345, 160–167. [Google Scholar] [CrossRef] [PubMed]
  57. Soler, M.; Gonzalez-Bartulos, M.; Soriano-Castell, D.; Ribas, X.; Costas, M.; Tebar, F.; Massaguer, A.; Feliu, L.; Planas, M. Identification of BP16 as a non-toxic cell-penetrating peptide with highly efficient drug delivery properties. Org. Biomol. Chem. 2014, 12, 1652–1663. [Google Scholar] [CrossRef] [PubMed]
  58. Jang, J.H.; Kim, M.Y.; Lee, J.W.; Kim, S.C.; Cho, J.H. Enhancement of the cancer targeting specificity of buforin lib by fusion with an anionic peptide via a matrix metalloproteinases-cleavable linker. Peptides 2011, 32, 895–899. [Google Scholar] [CrossRef] [PubMed]
  59. Rai, A.; Pinto, S.; Evangelista, M.B.; Gil, H.; Kallip, S.; Ferreira, M.G.; Ferreira, L. High-density antimicrobial peptide coating with broad activity and low cytotoxicity against human cells. Acta Biomater. 2016, 33, 64–77. [Google Scholar] [CrossRef] [PubMed]
  60. Rivero-Muller, A.; Vuorenoja, S.; Tuominen, M.; Waclawik, A.; Brokken, L.J.S.; Ziecik, A.J.; Huhtaniemi, I.; Rahman, N.A. Use of hecate-chorionic gonadotropin β conjugate in therapy of lutenizing hormone receptor expressing gonadal somatic cell tumors. Mol. Cell. Endocrinol. 2007, 269, 17–25. [Google Scholar] [CrossRef] [PubMed]
  61. Sanches, P.R.S.; Carneiro, B.M.; Batista, M.N.; Braga, A.C.S.; Lorenzon, E.N.; Rahal, P.; Cilli, E.M. A conjugate of the lytic peptide hecate and gallic acid: Structure, activity against cervical cancer, and toxicity. Amino Acids 2015, 47, 1433–1443. [Google Scholar] [CrossRef] [PubMed]
  62. Pal, S.; Tak, Y.K.; Han, E.; Rangasamy, S.; Song, J.M. A multifunctional composite of an antibacterial higher-valent silver metallopharmaceutical and a potent wound healing polypeptide: A combined killing and healing approach to wound care. New J. Chem. 2014, 38, 3889–3898. [Google Scholar] [CrossRef]
  63. Tati, S.; Li, R.; Puri, S.; Kumar, R.; Davidow, P.; Edgerton, M. Histatin 5-spermidine conjugates have enhanced fungicidal activity and efficacy as a topical therapeutic for oral candidiasis. Antimicrob. Agents Chemother. 2014, 58, 756–766. [Google Scholar] [CrossRef] [PubMed]
  64. Gao, G.; Cheng, J.T.J.; Kindrachuk, J.; Hancock, R.E.W.; Straus, S.K.; Kizhakkedathu, J.N. Biomembrane interactions reveal the mechanism of action of surface-immobilized host defense IDR-1010 peptide. Chem. Biol. 2012, 19, 199–209. [Google Scholar] [CrossRef] [PubMed]
  65. Ghaffar, K.A.; Hussein, W.M.; Khalil, Z.G.; Capon, R.J.; Skwarczynski, M.; Toth, I. Levofloxacin and indolicidin for combination antimicrobial therapy. Curr. Drug Deliv. 2015, 12, 108–114. [Google Scholar] [CrossRef] [PubMed]
  66. Johnson, G.A.; Muthukrishnan, N.; Pellois, J.P. Photoinactivation of Gram positive and Gram negative bacteria with the antimicrobial peptide (KLAKLAK)2 conjugated to the hydrophilic photosensitizer eosin Y. Bioconjug. Chem. 2013, 24, 114–123. [Google Scholar] [CrossRef] [PubMed]
  67. Johnson, G.A.; Ellis, E.A.; Kim, H.; Muthukrishnan, N.; Snavely, T.; Pellois, J.P. Photoinduced membrane damage of E. coli and S. aureus by the photosensitizer-antimicrobial peptide conjugate eosin-(KLAKLAK)2. PLoS ONE 2014, 9, e91220. [Google Scholar] [CrossRef] [PubMed]
  68. Mai, J.C.; Mi, Z.B.; Kim, S.H.; Ng, B.; Robbins, P.D. A proapoptotic peptide for the treatment of solid tumors. Cancer Res. 2001, 61, 7709–7712. [Google Scholar] [PubMed]
  69. Watkins, C.L.; Brennan, P.; Fegan, C.; Takayama, K.; Nakase, I.; Futaki, S.; Jones, A.T. Cellular uptake, distribution and cytotoxicity of the hydrophobic cell penetrating peptide sequence pfvyli linked to the proapoptotic domain peptide pad. J. Control. Release 2009, 140, 237–244. [Google Scholar] [CrossRef] [PubMed]
  70. Kim, J.M.; Jang, S.; Yang, M.H.; Cho, H.; Lee, K.H. Characterization of antibacterial activity and synergistic effect of cationic antibacterial peptide-resin conjugates. Bull. Korean Chem. Soc. 2011, 32, 3928–3932. [Google Scholar] [CrossRef]
  71. Zhong, J.; Chau, Y. Synthesis, characterization, and thermodynamic study of a polyvalent lytic peptide-polymer conjugate as novel anticancer agent. Bioconjug. Chem. 2010, 21, 2055–2064. [Google Scholar] [CrossRef] [PubMed]
  72. Reinhardt, A.; Horn, M.; Schmauck, J.P.G.; Brohl, A.; Giernoth, R.; Oelkrug, C.; Schubert, A.; Neundorf, I. Novel imidazolium salt-peptide conjugates and their antimicrobial activity. Bioconjug. Chem. 2014, 25, 2166–2174. [Google Scholar] [CrossRef] [PubMed]
  73. Postleb, F.; Stefanik, D.; Seifert, H.; Giernoth, R. Bionic liquids: Imidazolium-based ionic liquids with antimicrobial activity. Z. Naturforsch B 2013, 68, 1123–1128. [Google Scholar] [CrossRef]
  74. Li, Y.X.; Afrasiabi, R.; Fathi, F.; Wang, N.; Xiang, C.L.; Love, R.; She, Z.; Kraatz, H.B. Impedance based detection of pathogenic E. coli O157:H7 using a ferrocene-antimicrobial peptide modified biosensor. Biosens. Bioelectron. 2014, 58, 193–199. [Google Scholar] [CrossRef] [PubMed]
  75. Blin, T.; Purohit, V.; Leprince, J.; Jouenne, T.; Glinel, K. Bactericidal microparticles decorated by an antimicrobial peptide for the easy disinfection of sensitive aqueous solutions. Biomacromolecules 2011, 12, 1259–1264. [Google Scholar] [CrossRef] [PubMed]
  76. Arnusch, C.J.; Pieters, R.J.; Breukink, E. Enhanced membrane pore formation through high-affinity targeted antimicrobial peptides. PLoS ONE 2012, 7, e39768. [Google Scholar] [CrossRef] [PubMed]
  77. Liu, S.; Yang, H.; Wan, L.; Cai, H.W.; Li, S.F.; Li, Y.P.; Cheng, J.Q.; Lu, X.F. Enhancement of cytotoxicity of antimicrobial peptide magainin II in tumor cells by bombesin-targeted delivery. Acta Pharmacol. Sin. 2011, 32, 79–88. [Google Scholar] [CrossRef] [PubMed]
  78. Perekalin, D.S.; Novikov, V.V.; Pavlov, A.A.; Ivanov, I.A.; Anisimova, N.Y.; Kopylov, A.N.; Volkov, D.S.; Seregina, I.F.; Bolshov, M.A.; Kudinov, A.R. Selective ruthenium labeling of the tryptophan residue in the bee venom peptide melittin. Chem. Eur. J. 2015, 21, 4923–4925. [Google Scholar] [CrossRef] [PubMed]
  79. Franzel, B.; Frese, C.; Penkova, M.; Metzler-Nolte, N.; Bandow, J.E.; Wolters, D.A. Corynebacterium glutamicum exhibits a membrane-related response to a small ferrocene-conjugated antimicrobial peptide. J. Biol. Inorg. Chem. 2010, 15, 1293–1303. [Google Scholar] [CrossRef] [PubMed]
  80. Albada, H.B.; Prochnow, P.; Bobersky, S.; Langklotz, S.; Schriek, P.; Bandow, J.E.; Metzler-Nolte, N. Tuning the activity of a short Arg-Trp antimicrobial peptide by lipidation of a C- or N-terminal lysine side-chain. ACS Med. Chem. Lett. 2012, 3, 980–984. [Google Scholar] [CrossRef] [PubMed]
  81. Hoyer, J.; Schatzschneider, U.; Schulz-Siegmund, M.; Neundorf, I. Dimerization of a cell-penetrating peptide leads to enhanced cellular uptake and drug delivery. Beilstein J. Org. Chem. 2012, 8, 1788–1797. [Google Scholar] [CrossRef] [PubMed]
  82. Franzman, M.R.; Burnell, K.K.; Dehkordi-Vakil, F.H.; Guthmiller, J.M.; Dawson, D.V.; Brogden, K.A. Targeted antimicrobial activity of a specific IgG-SMAP28 conjugate against Porphyromonas gingivalis in a mixed culture. Int. J. Antimicrob. Agents 2009, 33, 14–20. [Google Scholar] [CrossRef] [PubMed]
  83. Leptihn, S.; Har, J.Y.; Chen, J.Z.; Ho, B.; Wohland, T.; Ding, J.L. Single molecule resolution of the antimicrobial action of quantum dot-labeled sushi peptide on live bacteria. BMC Biol. 2009, 7, 22. [Google Scholar] [CrossRef] [PubMed]
  84. Ferreira, S.Z.; Carneiro, H.C.; Lara, H.A.; Alves, R.B.; Resende, J.M.; Oliveira, H.M.; Silva, L.M.; Santos, D.A.; Freitas, R.P. Synthesis of a new peptide-coumarin conjugate: A potential agent against cryptococcosis. ACS Med. Chem. Lett. 2015, 6, 271–275. [Google Scholar] [CrossRef] [PubMed]
  85. Welling, M.M.; Bunschoten, A.; Kuil, J.; Nelissen, R.G.H.H.; Beekman, F.J.; Buckle, T.; van Leeuwen, F.W.B. Development of a hybrid tracer for spect and optical imaging of bacterial infections. Bioconjug. Chem. 2015, 26, 839–849. [Google Scholar] [CrossRef] [PubMed]
  86. Chen, H.; Liu, C.; Chen, D.; Madrid, K.; Peng, S.; Dong, X.; Zhang, M.; Gu, Y. Bacteria-targeting conjugates based on antimicrobial peptide for bacteria diagnosis and therapy. Mol. Pharm. 2015, 12, 2505–2516. [Google Scholar] [CrossRef] [PubMed]
  87. Liu, F.; Ni, A.S.Y.; Lim, Y.; Mohanram, H.; Bhattacharjya, S.; Xing, B.G. Lipopolysaccharide neutralizing peptide-porphyrin conjugates for effective photoinactivation and intracellular imaging of Gram-negative bacteria strains. Bioconjug. Chem. 2012, 23, 1639–1647. [Google Scholar] [CrossRef] [PubMed]
  88. Yadav, S.; Mahato, M.; Pathak, R.; Jha, D.; Kumar, B.; Deka, S.R.; Gautam, H.K.; Sharma, A.K. Multifunctional self-assembled cationic peptide nanostructures efficiently carry plasmid DNA in vitro and exhibit antimicrobial activity with minimal toxicity. J. Mater. Chem. B 2014, 2, 4848–4861. [Google Scholar] [CrossRef]
  89. Arnusch, C.J.; Ulm, H.; Josten, M.; Shadkchan, Y.; Osherov, N.; Sahl, H.G.; Shai, Y. Ultrashort peptide bioconjugates are exclusively antifungal agents and synergize with cyclodextrin and amphotericin B. Antimicrob. Agents Chemther. 2012, 56, 1–9. [Google Scholar] [CrossRef] [PubMed]
  90. Bera, S.; Zhanel, G.G.; Schweizer, F. Synthesis and antibacterial activity of amphiphilic lysine-ligated neomycin B conjugates. Carbohydr. Res. 2011, 346, 560–568. [Google Scholar] [CrossRef] [PubMed]
  91. Magoulas, G.E.; Kostopoulou, O.N.; Garnelis, T.; Athanassopoulos, C.M.; Kournoutou, G.G.; Leotsinidis, M.; Dinos, G.P.; Papaioannou, D.; Kalpaxis, D.L. Synthesis and antimicrobial activity of chloramphenicol-polyamine conjugates. Bioorgan. Med. Chem. 2015, 23, 3163–3174. [Google Scholar] [CrossRef] [PubMed]
  92. Brouwer, C.P.J.M.; Bogaards, S.J.P.; Wulferink, M.; Velders, M.P.; Welling, M.M. Synthetic peptides derived from human antimicrobial peptide ubiquicidin accumulate at sites of infections and eradicate (multi-drug resistant) Staphylococcus aureus in mice. Peptides 2006, 27, 2585–2591. [Google Scholar] [CrossRef] [PubMed]
  93. Kumar, V.; Jones, G.S.; Blacksberg, I.; Remers, W.A.; Misiek, M.; Pursiano, T.A. Aminoglycoside antibiotics. 3. Epimino derivatives of neamine, ribostamycin, and kanamycin-B. J. Med. Chem. 1980, 23, 42–49. [Google Scholar] [CrossRef] [PubMed]
  94. Zhang, J.J.; Chiang, F.I.; Wu, L.; Czyryca, P.G.; Li, D.; Chang, C.W.T. Surprising alteration of antibacterial activity of 5″-modified neomycin against resistant bacteria. J. Med. Chem. 2008, 51, 7563–7573. [Google Scholar] [CrossRef] [PubMed]
  95. Borkow, G.; Vijayabaskar, V.; Lara, H.H.; Kalinkovich, A.; Lapidot, A. Structure-activity relationship of neomycin, paromomycin, and neamine-arginine conjugates, targeting HIV-1 gp120-CXCR4 binding step. Antivir. Res. 2003, 60, 181–192. [Google Scholar] [CrossRef]
  96. Chu-Kung, A.F.; Bozzelli, K.N.; Lockwood, N.A.; Haseman, J.R.; Mayo, K.H.; Tirrell, M.V. Promotion of peptide antimicrobial activity by fatty acid conjugation. Bioconjug. Chem. 2004, 15, 530–535. [Google Scholar] [CrossRef] [PubMed]
  97. Wenzel, M.; Schriek, P.; Prochnow, P.; Albada, H.B.; Metzler-Nolte, N.; Bandow, J.E. Influence of lipidation on the mode of action of a small RW-rich antimicrobial peptide. Biochim. Biophys. Acta 2015, 1858, 1004–1011. [Google Scholar] [CrossRef] [PubMed]
  98. Dai, T.; Huang, Y.Y.; Hamblin, M.R. Photodynamic therapy for localized infections-state of the art. Photodiagn. Photodyn. 2009, 6, 170–188. [Google Scholar] [CrossRef] [PubMed]
  99. Kochevar, I.E.; Redmond, R.W. Photosensitized production of singlet oxygen. Method Enzymol. 2000, 319, 20–28. [Google Scholar]
  100. Maisch, T.; Hackbarth, S.; Regensburger, J.; Felgentrager, A.; Baumler, W.; Landthaler, M.; Roder, B. Photodynamic inactivation of multi-resistant bacteria (pib)—A new approach to treat superficial infections in the 21st century. J. Dtsch. Dermatol. Ges. 2011, 9, 360–366. [Google Scholar] [CrossRef] [PubMed]
  101. Vera, D.M.A.; Haynes, M.H.; Ball, A.R.; Dai, T.H.; Astrakas, C.; Kelso, M.J.; Hamblin, M.R.; Tegos, G.P. Strategies to potentiate antimicrobial photoinactivation by overcoming resistant phenotypes. Photochem. Photobiol. 2012, 88, 499–511. [Google Scholar] [CrossRef] [PubMed]
  102. Segalla, A.; Borsarelli, C.D.; Braslavsky, S.E.; Spikes, J.D.; Roncucci, G.; Dei, D.; Chiti, G.; Jori, G.; Reddi, E. Photophysical, photochemical and antibacterial photosensitizing properties of a novel octacationic Zn(II)-phthalocyanine. Photochem. Photobiol. Sci. 2002, 1, 641–648. [Google Scholar] [CrossRef] [PubMed]
  103. Usacheva, M.N.; Teichert, M.C.; Biel, M.A. Comparison of the methylene blue and toluidine blue photobactericidal efficacy against Gram-positive and Gram-negative microorganisms. Lasers Surg. Med. 2001, 29, 165–173. [Google Scholar] [CrossRef] [PubMed]
  104. Maisch, T.; Bosl, C.; Szeimies, R.M.; Lehn, N.; Abels, C. Photodynamic effects of novel XF porphyrin derivatives on prokaryotic and eukaryotic cells. Antimicrob. Agents Chemther. 2005, 49, 1542–1552. [Google Scholar] [CrossRef] [PubMed]
  105. Bonnett, R.; Buckley, D.G.; Burrow, T.; Galia, A.B.B.; Saville, B.; Songca, S.P. Photobactericidal materials based on porphyrins and phthalocyanines. J. Mater. Chem. 1993, 3, 323–324. [Google Scholar] [CrossRef]
  106. Dahl, T.A.; Midden, W.R.; Hartman, P.E. Comparison of killing of Gram-negative and Gram-positive bacteria by pure singlet oxygen. J. Bacteriol. 1989, 171, 2188–2194. [Google Scholar] [PubMed]
  107. Perria, C.; Carai, M.; Falzoi, A.; Orunesu, G.; Rocca, A.; Massarelli, G.; Francaviglia, N.; Jori, G. Photodynamic therapy of malignant brain-tumors—Clinical-results of, difficulties with, questions about, and future-prospects for the neurosurgical applications. Neurosurgery 1988, 23, 557–563. [Google Scholar] [CrossRef] [PubMed]
  108. Yih, T.C.; Al-Fandi, M. Engineered nanoparticles as precise drug delivery systems. J. Cell. Biochem. 2006, 97, 1184–1190. [Google Scholar] [CrossRef] [PubMed]
  109. Gao, G.Z.; Lange, D.; Hilpert, K.; Kindrachuk, J.; Zou, Y.Q.; Cheng, J.T.J.; Kazemzadeh-Narbat, M.; Yu, K.; Wang, R.Z.; Straus, S.K.; et al. The biocompatibility and biofilm resistance of implant coatings based on hydrophilic polymer brushes conjugated with antimicrobial peptides. Biomaterials 2011, 32, 3899–3909. [Google Scholar] [CrossRef] [PubMed]
  110. Hilpert, K.; Elliott, M.; Jenssen, H.; Kindrachuk, J.; Fjell, C.D.; Korner, J.; Winkler, D.F.H.; Weaver, L.L.; Henklein, P.; Ulrich, A.S.; et al. Screening and characterization of surface-tethered cationic peptides for antimicrobial activity. Chem. Biol. 2009, 16, 58–69. [Google Scholar] [CrossRef] [PubMed]
  111. Eckert, R. Road to clinical efficacy: Challenges and novel strategies for antimicrobial peptide development. Future Microbiol. 2011, 6, 635–651. [Google Scholar] [CrossRef] [PubMed]
  112. Bandow, J.E.; Metzler-Nolte, N. New ways of killing the beast: Prospects for inorganic-organic hybrid nanomaterials as antibacterial agents. Chembiochem 2009, 10, 2847–2850. [Google Scholar] [CrossRef] [PubMed]
  113. Chantson, J.T.; Falzacappa, M.V.V.; Crovella, S.; Metzler-Nolte, N. Solid-phase synthesis, characterization, and antibacterial activities of metallocene-peptide bioconjugates. Chemmedchem 2006, 1, 1268–1274. [Google Scholar] [CrossRef] [PubMed]
  114. Chan, D.I.; Prenner, E.J.; Vogel, H.J. Tryptophan- and arginine-rich antimicrobial peptides: Structures and mechanisms of action. BBA-Biomembranes 2006, 1758, 1184–1202. [Google Scholar] [CrossRef] [PubMed]
  115. Oudhoff, M.J.; Bolscher, J.G.M.; Nazmi, K.; Kalay, H.; Hof, W.V.T.; Amerongen, A.V.N.; Veerman, E.C.I. Histatins are the major wound-closure stimulating factors in human saliva as identified in a cell culture assay. FASEB J. 2008, 22, 3805–3812. [Google Scholar] [CrossRef] [PubMed]
  116. Mannoor, M.S.; Zhang, S.Y.; Link, A.J.; McAlpine, M.C. Electrical detection of pathogenic bacteria via immobilized antimicrobial peptides. Proc. Natl. Acad. Sci. USA 2010, 107, 19207–19212. [Google Scholar] [CrossRef] [PubMed]
  117. Moreno, M.; Giralt, E. Three valuable peptides from bee and wasp venoms for therapeutic and biotechnological use: Melittin, apamin and mastoparan. Toxins 2015, 7, 1126–1150. [Google Scholar] [CrossRef] [PubMed]
  118. Szczepanski, C.; Tenstad, O.; Baumann, A.; Martinez, A.; Myklebust, R.; Bjerkvig, R.; Prestegarden, L. Identification of a novel lytic peptide for the treatment of solid tumours. Genes Cancer 2014, 5, 186–200. [Google Scholar] [PubMed]
  119. Dathe, M.; Wieprecht, T.; Nikolenko, H.; Handel, L.; Maloy, W.L.; MacDonald, D.L.; Beyermann, M.; Bienert, M. Hydrophobicity, hydrophobic moment and angle subtended by charged residues modulate antibacterial and haemolytic activity of amphipathic helical peptides. FEBS Lett. 1997, 403, 208–212. [Google Scholar] [CrossRef]
  120. Javadpour, M.M.; Juban, M.M.; Lo, W.C.J.; Bishop, S.M.; Alberty, J.B.; Cowell, S.M.; Becker, C.L.; McLaughlin, M.L. De novo antimicrobial peptides with low mammalian cell toxicity. J. Med. Chem. 1996, 39, 3107–3113. [Google Scholar] [CrossRef] [PubMed]
  121. Alves, I.D.; Carre, M.; Montero, M.P.; Castano, S.; Lecomte, S.; Marquant, R.; Lecorche, P.; Burlina, F.; Schatz, C.; Sagan, S.; et al. A proapoptotic peptide conjugated to penetratin selectively inhibits tumor cell growth. BBA-Biomembranes 2014, 1838, 2087–2098. [Google Scholar] [CrossRef] [PubMed]
  122. Smolarczyk, R.; Cichon, T.; Graja, K.; Hucz, J.; Sochanik, A.; Szala, S. Antitumor effect of RGD-4C-GG-D(KLAKLAK)2 peptide in mouse B16(F10) melanoma model. Acta Biochim. Pol. 2006, 53, 801–805. [Google Scholar] [PubMed]
  123. Mi, Z.B.; Mai, J.; Lu, X.L.; Robbins, P.D. Characterization of a class of cationic peptides able to facilitate efficient protein transduction in vitro and in vivo. Mol. Ther. 2000, 2, 339–347. [Google Scholar] [CrossRef] [PubMed]
  124. Larrick, J.W.; Hirata, M.; Balint, R.F.; Lee, J.; Zhong, J.; Wright, S.C. Human cap18—A novel antimicrobial lipopolysaccharide-binding protein. Infect. Immun. 1995, 63, 1291–1297. [Google Scholar] [PubMed]
  125. Neundorf, I.; Rennert, R.; Hoyer, J. Fusion of a short HA2-derived peptide sequence to cell-penetrating peptides improves cytosolic uptake, but enhances cytotoxic activity. Pharmaceuticals 2009, 2, 49–65. [Google Scholar] [CrossRef]
  126. Foekens, J.A.; Kos, J.; Peters, H.A.; Krasovec, M.; Look, M.P.; Cimerman, N.; Meijer-van Gelder, M.E.; Henzen-Logmans, S.C.; van Putten, W.L.J.; Klijn, J.G.M. Prognostic significance of cathepsins B and L in primary human breast cancer. J. Clin. Oncol. 1998, 16, 1013–1021. [Google Scholar] [PubMed]
  127. Splith, K.; Hu, W.N.; Schatzschneider, U.; Gust, R.; Ott, I.; Onambele, L.A.; Prokop, A.; Neundorf, I. Protease-activatable organometal-peptide bioconjugates with enhanced cytotoxicity on cancer cells. Bioconjug. Chem. 2010, 21, 1288–1296. [Google Scholar] [CrossRef] [PubMed]
  128. Al-Rifai, A.A.; Ayoub, M.T.; Shakya, A.K.; Abu Safieh, K.; Mubarak, M.S. Synthesis, characterization, and antimicrobial activity of some new coumarin derivatives. Med. Chem. Res. 2012, 21, 468–476. [Google Scholar] [CrossRef]
  129. Tietze, A.A.; Bordusa, F.; Giernoth, R.; Imhof, D.; Lenzer, T.; Maass, A.; Mrestani-Klaus, C.; Neundorf, I.; Oum, K.; Reith, D.; et al. On the nature of interactions between ionic liquids and small amino-acid-based biomolecules. Chemphyschem 2013, 14, 4044–4064. [Google Scholar] [CrossRef] [PubMed]
  130. Xhindoli, D.; Pacor, S.; Benincasa, M.; Scocchi, M.; Gennaro, R.; Tossi, A. The human cathelicidin LL-37 a pore-forming antibacterial peptide and host-cell modulator. BBA-Biomembranes 2016, 1858, 546–566. [Google Scholar] [CrossRef] [PubMed]
  131. Salomone, F.; Cardarelli, F.; Di Luca, M.; Boccardi, C.; Nifosi, R.; Bardi, G.; Di Bari, L.; Serresi, M.; Beltram, F. A novel chimeric cell-penetrating peptide with membrane-disruptive properties for efficient endosomal escape. J. Control. Release 2012, 163, 293–303. [Google Scholar] [CrossRef] [PubMed]
  132. Luan, L.; Meng, Q.B.; Xu, L.; Meng, Z.; Yan, H.S.; Liu, K.L. Peptide amphiphiles with multifunctional fragments promoting cellular uptake and endosomal escape as efficient gene vectors. J. Mater. Chem. B 2015, 3, 1068–1078. [Google Scholar] [CrossRef]
Table
Table 1. Overview of AMP conjugates discussed in this study. AMPs are listed in alphabetical order.
Table 1. Overview of AMP conjugates discussed in this study. AMPs are listed in alphabetical order.
Antimicrobial Peptide and SequenceConjugated GroupCoupling MethodStrains and Organisms TestedRef.
Apidaecin IbPorphyrinAmide bondEscherichia coli (ATCC 25922); P. aeruginosa (ATCC 25668); MRSA (ATCC BAA 44)[55]
GNNRPVYIPQPRPPHPRL
AKK-motif/LKK-motifFatty acidsAmide bondE. coli (DH5α, ML-35); S. epidermidis (ATCC 12228)[56]
YGAA(KKAAKAA)2/YG(AKAKAAKA)2
BP16ChlorambucilAmide bond3T3; MCF-7; CAPAN-1[57]
KKLFKKILKKL
Buforin IIbTargeting peptideAmide bondFSF; HeLa; B16-F0; HT1080; U87MG[58]
RAGLQFPVG(RLLR)3
Cecropin-melittinAu particlesThioetherS. aureus (ATCC 6538); E. coli (ATCC 25922); K. pneumoniae (ATCC 10031); P. aeruginosa (ATCC 15442); multidrug-resistant E. coli; S. haemolyticus HUVECs; NDHF[59]
KWKLFKKIGAVLKVL
Hecate FALALKALKKALKKLKKALKKALChorionic gonadotropin-βAmide bondMurine Leydig tumor BLT-1 cells[60]
Gallic acidAmide bondHeLa; HaCat[61]
Histatin-1[Ag(II)CHX]Complex conjugateA. calcoaceticus (ATCC 23055); C. freundii (ATCC 6750); K. pneumonia (ATCC 10031); P. aeruginosa (ATCC 27853); E. faecalis (ATCC 29212); S. aureus (ATCC 25923); S. epidermis (ATCC 12228); P. bacterium acnes (ATCC 6919) 3T3-L1 preadipocyte[62]
DSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN
Histatin-5SpermidineAmide bondC. albicans (CAF4-2); C. glabrata (931010, 90032, 90030)[63]
DSHAKRHHGYKRKFHEKHHSHRGY
IDR-1010cysQuartz slidesThioetherP. aeruginosa[64]
IRWRIRVWVRRIC
IndolicinLevofloxacinAmide bond/ester linkageE. coli (ATCC 11775); P. aeruginosa (ATCC 10145); S. aureus (ATCC 25923, ATCC 9144); B. subtilis (ATCC 6051, ATCC 6633)[65]
ILPWKWPWWPWRR
KLA, proapoptotic domain peptide (KLAKLAK)2Eosin YAmide bondS. aureus (8325-4, ATCC 29213); S. pyogenes (12202); P. aeruginosa (PA01); E. coli (ATCC 25992; BL21 DE3)[66,67]
PTD-5Amide bondMCA-205 murine fibrosarcoma line; human head and neck tumor clinical isolates (22B and 4129)[68]
Octaarginine/PFVYLIAmide bondKG1a; HeLa[69]
KSL7/KSL8PEG-PS resinAmide bondM. luteus (ATCC 9341); S. aureus (ATCC 6538); E. coli (ATCC 25922); P. aeruginosa (ATCC 9027)[70]
FKVKFKVKVK/ LKVVFKVLFK
KW3DextranCuAACMCF-7, PC-3, NIH/3T3, MES-SA, MES-SA/Dx5[71]
KWKWKW
LL-37Imidazolium saltAmide bondB. subtilis (ATTC 6633); E. coli K12 (MG 1625); M. phlei (DSM 48214); MRSA; VRE[72,73]
LGDFFRSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Magainin IFerroceneAmide bondE. coli K12; S. epidermidis; B. subtilis[74]
GIGKFLHSAGKFGKAFVGEIMKSSilica particlesSulfide bondL. ivanovii[75]
Magainin IIVancomycinCuAACMRSA (15A761, 15A763); VSE (15A797); VRE (15A799); M. catarrhalis (58L028)[76]
GIGKFLHSAKKFGKAFVGEIMNSBombesinAmide bondMCF-7; ZR-75-30; A375; M14; A875; DU145; HeLa; A549; Raji; NB4; Vero E6; Hek-293A, HSF; HUVECs; hPBMCs[77]
Melittin[(C5H5)Ru]+ComplexSKOV3, MDA-MB-231, CBA mice[78]
GIGAVLKVLTTGLPALIS
MP66FerroceneAmide bondC. glutamicum (ATTC 13032)[79]
WRWRW
MP196LipidsAmide bondE. coli (DSM 30083); A. baumannii (DSM 30007); P. aeruginosa (DSM 50071); S. aureus (DSM 20231, ATCC 43300); B. subtilis (168 DSM 402) MCF-7; HT29; Fibroblast (GM5657)[66,80]
RWRWRW
Tat48-59LevofloxacinAmide bond/ester linkageE. coli (ATCC 11775); P. aeruginosa (ATCC 10145); S. aureus (ATCC 25923, ATCC 9144); B. subtilis (ATCC 6051, ATCC 6633)[65]
GRKKRRQRRRPQ
sC18Imidazolium saltAmide bondB. subtilis (ATTC 6633); E. coli K12 (MG 1625); M. phlei (DSM 48214); MRSA; VRE[72,73]
GLRKRLRKFRNKIKEK
(sC18)2Chlorambucil/KLAAmide bondHEK-293; MCF-7; HT-29[81]
GLRK(GLRKRLRKFRNKIKEK)RLRKFRNKIKEK
SMAP28IgGThioetherP. gingivalis (381); A. actinomycetemcomitans (FDC-Y4); P. micros[82]
RGLRRLGRKIAHGVKKYGPTVLRIIRIA
Sushi IQuantum dot/nanogoldBiotin/streptavidinE. coli (ATCC 25922)[83]
GFKLKGMARISCLPNGQWSNFPPKCIRECAMVS
Ubiquicidin29-41CoumarinCuAACMDA-MB-435; female athymic nude mice[84]
TGRAKRRMQYNRRHybrid label of Cy5 dye and DTPA chelatorAmide bondS. aureus (ATCC 29213); S. epidermidis (ATCC 12228); K. pneumoniae (ATCC 43861); E. coli (ATCC 25922); B. subtilis (JH642) GE11-β3 Swiss mice[85]
ChloramphenicolAmide bondS. aureus; E. coli; P. aeruginosa; B. subtilis; L-02; HBL-100; HELF athymic nude mice; normal mice[86]
YI13WFProtoporphyrin IXThioetherE. coli DH5a (ATCC 53868); S. enterica (ATCC 14028); E. coli BL21 (AmprE. coli); K. pneumoniae (ATCC 700603); Jurkat T cells[87]
YVLWKRKRKFCFI
Other AMP like sequences
DehydropeptideNeomycin BAmide bondE. coli MG1655 (MTCC 1586); P. aeruginosa (MTCC 741); S. typhimurium (MTCC 98); B. subtilis (MTCC 121, MTCC 430); S. aureus (MTCC 740)[88]
Boc-FΔF-εAhx
Lysine based tetrapeptidesBiotin, vitamin E, cholesterolAmide bond42 different bacterial and fungal strains (especially Aspergillus and Candida)[89]
WWK-motifNeomycin BAmide bondS. aureus (ATCC 29213); MRSA (ATCC 33592); S. epidermidis (ATCC 14990); MRSE (CAN-ICU 61589); S. pneumoniae (ATCC 49619); E. coli (ATCC 25922; CAN-ICU 61714); P. aeruginosa (ATCC 27853; CAN-ICU 62308)[90]

Share and Cite

MDPI and ACS Style

Reinhardt, A.; Neundorf, I. Design and Application of Antimicrobial Peptide Conjugates. Int. J. Mol. Sci. 2016, 17, 701. https://doi.org/10.3390/ijms17050701

AMA Style

Reinhardt A, Neundorf I. Design and Application of Antimicrobial Peptide Conjugates. International Journal of Molecular Sciences. 2016; 17(5):701. https://doi.org/10.3390/ijms17050701

Chicago/Turabian Style

Reinhardt, Andre, and Ines Neundorf. 2016. "Design and Application of Antimicrobial Peptide Conjugates" International Journal of Molecular Sciences 17, no. 5: 701. https://doi.org/10.3390/ijms17050701

APA Style

Reinhardt, A., & Neundorf, I. (2016). Design and Application of Antimicrobial Peptide Conjugates. International Journal of Molecular Sciences, 17(5), 701. https://doi.org/10.3390/ijms17050701

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop