Antimicrobial Peptides Can Generate Tolerance by Lag and Interfere with Antimicrobial Therapy

Abstract

Antimicrobial peptides (AMPs) are widely distributed molecules secreted mostly by cells of the innate immune system to prevent bacterial proliferation at the site of infection. As with classic antibiotics, continued treatment with AMPs can create resistance in bacteria. However, whether AMPs can generate tolerance as an intermediate stage towards resistance is not known. Here, we show that the treatment of Escherichia coli with different AMPs induces tolerance by lag, particularly for those peptides that have internal targets. This tolerance can be detected as different morphological and physiological changes, which depend on the type of peptide molecule the bacterium has been exposed to. In addition, we show that AMP tolerance can also affect antibiotic treatment. The genomic sequencing of AMP-tolerant strains shows that different mutations alter membrane composition, DNA replication, and translation. Some of these mutations have also been observed in antibiotic-resistant strains, suggesting that AMP tolerance could be a relevant step in the development of antibiotic resistance. Monitoring AMP tolerance is relevant vis-á-vis the eventual therapeutic use of AMPs and because cross-tolerance might favor the emergence of resistance against conventional antibiotic treatments.

1. Introduction

Tolerant bacteria can emerge when cell cultures are periodically treated with antibiotics. The tolerant phenotype does not provide resistance to antibiotics, i.e., the antibiotic minimum inhibitory concentration (MIC) remains unchanged [1]. However, it does allow the cells to survive longer due to mutations that lengthen the latency state [2,3]. This tolerant state precedes resistance since the acquired mutations allow the bacteria to survive longer, increasing the likelihood of developing resistance. In fact, a tolerant state has been proposed as an intermediate step required for the ultimate development of resistance [4]. However, tolerance by lag has not yet been described for all antibiotics, particularly not for AMPs.

In the current context of increasingly resistant strains and scarcity of new antibiotics, AMPs are one of the most promising strategies to treat infections by antibiotic-resistant bacteria [5]. AMPs are widely distributed in nature and have a very potent activity and a broad mechanism of action [6]. Since their discovery, only a few AMPs have reached the market and are used to treat bacterial infections, though many AMPs are currently under clinical trial [7]. Although AMP action is mainly associated with cell membrane disruption [8,9], AMPs can also exert their action by interacting with internal targets after peptide internalization by a non-membranolytic mechanism [10] or even work as immune system regulators [11,12]. Although long-term treatment with AMPs can also lead to resistant strains, as found for colistin [13], there are only a few studies addressing the development of tolerance and how it may affect the treatment of infections [14].

Here, we present evidence that AMP treatment can induce tolerance by lag, particularly when there is an internal AMP target. These tolerant strains have phenotypes very similar to those already described by antibiotics, with colony morphologies of reduced size, an increase in the latency phase, and less pronounced lethality curves. Our results show that these tolerant strains can hinder the action of other antimicrobials, including conventional antibiotics. In this context, we propose that tolerance by lag should be considered when developing new AMPs, as well as the collateral effects in the treatment of infections with antibiotics.

2. Materials and Methods

2.1. Materials

Escherichia coli strain was purchased from the Coli Genetic Stock Center (BW25113). All peptides except PolB (Thermo Fisher, Hampshire, UK) were synthesized by Fmoc solid-phase synthesis, as previously described [15]. Ampicillin was purchased from Merck (Darmstadt, Germany), kanamycin from Apollo Scientific (Stockport, UK), ciprofloxacin and nalidixic acid from Thermo Fisher (Hampshire, UK).

2.2. Peptide Tolerant Strain Development and Data Processing

Overnight E. coli cultures were grown in LB medium, and inoculums were prepared by dilution at 1:100 in fresh LB media (500 μL total volume). The cultures were incubated at 37 °C and 600 rpm in an Accutherm Microtube Shaking Incubator (Labnet International; Edison, NJ, USA) at the corresponding MIC concentration (

Table 1. AMP sequences and MIC under assay conditions.

Description	Sequence a	Isoelectric Point	Molecular Weight		MIC c (µM)
			Theory	Found
Polymyxin B	BTB(BBfLBBT)	10.5	1385.6	- b	0.2
LL-37	[LL-37, 37 aa]	11.1	4493.3	4492.3	50
Pleurocidin	GWGSFFKKAAHVGKHVGKAALTHYL	10.8	2711.1	2710.3	6.3
Dermaseptin	ALWKTMLKKLGTMALHAGKAALGAAADTISQGTQ	10.7	3455.1	3455.1	50

^a Cyclic structure within parenthesis; lower case denotes D-amino acid residues; B: α-diaminobutyric acid; ^b polymyxin B sulphate was obtained commercially; C MIC was measured at 107 CFU/mL; ^c MIC values performed with an inoculum of 1:100 ON E. coli cultures (~10⁷ CFU/mL).

) for the corresponding time to ensure < 0.1% survival. Exposure times were 40, 30, 60, and 80 min for polymyxin B (PolB), pleurocidin (Pleu), LL-37, and dermaseptin (Derm), respectively. After incubation, a sample of 400 μL from each assay was resuspended in 8 mL of fresh LB media to regrow the bacteria for the next cycle. The remaining volume (100 μL) was plated on Petri dishes. Plates were scanned every 15 min in an Epson Perfection V200 Photo instrument (Epson, Nagano, Japan) to monitor colony appearance time. Lag times were calculated from serial images using the ScanLag script, as previously described [16]. To determine colony size after the first incubation cycle, surviving cells after AMP treatment were plated on Petri dishes and allowed to grow overnight. Then, agar plates were scanned, and colony size was calculated using ImageJ (version 1.52p, National Institute of Health, Bethesda, MD, USA).

2.3. Minimum Inhibitory Concentration (MIC)

Detection of bacterial growth inhibition was performed as previously described [17], using a standard dilution at 10⁷ CFU/mL in Muller–Hinton medium to determine the incubation conditions for the assay, and 5 × 10⁵ to detect resistance in bacteria cells. The MIC was defined as the last antimicrobial concentration where no visual growth could be detected.

2.4. Killing Curve Assay

Bacterial killing curves were measured by colony count in Petri plates at defined time points. Samples (500 μL, containing 450 μL of 1:100 bacteria overnight culture in LB media and 50 μL of 10× MIC AMP stocks) were taken at different times during the incubation with peptides and plated to Petri plates. After overnight incubation at 37 °C, CFUs were counted, and survival rates at each point were calculated in comparison with an initial inoculum.

2.5. DNA Purification and Genome Sequencing

QIAamp^® DNA Mini Kit (Qiagen, Germantown, MD) was used to isolate the E. coli whole genome in the wild-type strain and evolved strains following the manufacturer’s instructions. Purified whole genomes were sequenced with Oxford Nanopore (Oxford, UK).

Reads were mapped to E. coli GCA_016811855.1 with BWA-MEM 0.7.17 [18]. Alignment files containing only properly paired, uniquely mapping reads without duplicates were processed using Picard (http://broadinstitute.github.io/picard/ (accessed on 18 September 2022) to add read groups and remove duplicates. The Genome Analysis Tool Kit (GATK 4.1.8.0) HaplotypeCaller [19] was used for variant calling. Joint genotyping was performed with combined gvcfs. Functional annotations were added using SnpEff v.5 with the E. coli database [20]. Best-practices GATK filters were applied and variants with at least one sample containing a variant with a read depth of at least 5 were retained. CNV prediction was performed with ControlFREEC 11.5 [21], using a pool of samples as CNV baseline and using windows of 20 kb and 50 kb. CNV calls from all samples that were less than 10 kb apart were merged using Survivor [22].

2.6. Statistical Analysis

All experiments were performed in triplicate, and values are displayed as the mean ± SEM (standard error of the mean). Statistical significance was evaluated using a t-test (α = 0.05) and p-values are reported as follows: * p < 0.05, ** p < 0.01, *** p < 0.005, **** p < 0.001.

3. Results

3.1. Antimicrobial Peptides Generate Tolerance by Lag

Tolerance by lag (henceforth tolerance) can emerge when bacterial cultures are periodically treated with antibiotic concentrations equivalent to or higher than the MIC for a limited time. Under these conditions, some cells can survive treatment and adjust to stress conditions, later becoming tolerant and increasing their population survival rate. To determine the existence of tolerance in the case of AMPs, we selected four peptides with different mechanisms of action (Table 1). On the one hand, we selected PolB and LL-37 because they display a classic mechanism of action, involving partial insertion into the membrane and subsequent depolarization leading to bacterial cell death [23,24]. On the other hand, Pleu and Derm were selected as peptides that enter the bacterium cytoplasm and interact with internal targets, affecting essential metabolic processes [25,26]. We incubated the cells with peptides at the MIC and optimized the incubation time for each peptide to ensure a survival percentage below 0.1% (Figure 1a). After 10 sequential cycles of evolution, an increase in cell survival was observed, with final values ranging from 0.1% to 10% or even higher (Figure 1b). Under these conditions, resistance was only observed for PolB after 8 incubation cycles. This development of resistance was specific to this AMP, and no cross-resistance was observed with other peptides ( Supplementary Table S1).

After treating the bacterial cultures with AMPs, all cultures showed a characteristic decrease in colony size when surviving cells were plated in Petri dishes, except for LL-37 (Figure 2a). These results suggest that cells respond to the stress caused by AMPs and decrease their metabolism to become less susceptible, probably by increasing the lag time. However, this phenotype could be transient or could later be fixed in the genome to generate tolerance. One of the most distinctive features of tolerance is the increase in the lag phase after repeated cycles of incubation. To elucidate whether the treatment with AMPs produced similar characteristics, we used ScanLag to measure colony size distribution after each cycle of evolution. This method measures the distribution of lag times in individual cells from serial images of individual colonies in Petri dishes. In this way, we were able to observe significant differences in colony size after AMP treatment (Figure 2b). Pleu displayed the largest effect, of magnitude comparable to ampicillin, as previously described [1]. These effects were observed even after the first incubation cycle, reaching maximum values after 3–4 cycles. Derm generated tolerance in later incubation cycles, and the effect, although milder compared to Pleu, was significant. On the other hand, the effect was almost zero for LL-37 and, for PolB, we even observed a decrease in the lag phase. While PolB could generate small colonies after the first incubation, the phenotype was not retained in later cycles, suggesting that the trait was not fixed in the genome. The observed results suggest that tolerance in AMPs appears to be indicative of intracellular targets, while membrane-level effects would not cause a measurable effect.

3.2. Tolerance in AMPs Can Affect Antimicrobial Treatments

After evolving E. coli cells to be tolerant to different AMPs, we investigated whether the strains were cross-tolerant to other AMPs or, on the contrary, the phenotype was AMP-specific. To this end, we determined the lethality curves for each of the evolved strains with all AMPs used in this study (Figure 3). We observed that, in general, strains evolved with an AMP developed tolerance against that same AMP. In line with ScanLag results, the Pleu-evolved strain was the one that displayed a larger effect, which can be observed even after the second incubation cycle. For Derm, a significant tolerance was also observed, with a drop in the slope of the lethality curve from cycle 4 onwards. For LL-37 and PolB, we did not find significant changes in the lethality curves. In the case of PolB, it should be noted that the resistance was detected in cycle 8, so the observed changes in the lethality curve should not be attributed to tolerance. In those cases where cross-tolerance to different AMPs was observed, the effects were generally small and, in most cases, not significant. The absence of cross-tolerance between Derm and Pleu suggests that, despite their both acting on internal targets, the mechanism of action would be different. A slight cross-tolerance to LL-37 was observed in strains evolved with Derm, which could be due to non-specific changes at the cell membrane level.

Finally, we investigated whether our evolved strains could display cross-tolerance with classical antibiotics. To this end, strains evolved with either LL-37 or Pleu were incubated with ampicillin (binds penicillin-binding proteins and inhibits cell wall synthesis), kanamycin (binds the ribosome, inhibiting translation), ciprofloxacin (binds topoisomerase IV, inhibiting replication), and nalidixic acid (binds DNA gyrase, inhibiting transcription and replication). In all cases, evolved strains displayed the same MIC against the antibiotics, compared with the parental strain, showing that they were not antibiotic-resistant (Supplementary Table S2). However, significant effects were observed in kanamycin action against strains evolved with Pleu, as detected by the killing curves (Figure 4). Interestingly, these effects sensitized E. coli to kanamycin, suggesting that, even if both antimicrobials can bind the ribosome, the site of action might be different. These findings are in tune with earlier observations that resistance to a given AMP could sensitize bacterial cells to other antimicrobials [27]. We also observed a significant difference in ciprofloxacin and nalidixic acid for Pleu-evolved strains, suggesting a pleiotropic binding to cytoplasmatic proteins (Figure 4). In these cases, the evolved strains displayed tolerance to antibiotics, reflected as slower killing curves. These results are also consistent with previous reports in which Pleu at high concentrations could inhibit transcription, translation, and replication in bacterial cells.

3.3. The Tolerance Mutational Landscape Is Diverse

We showed that AMP tolerance can be fixed in the genome, as we detected a significant change in the lethality curve of the evolved strains. To determine the mutations responsible for that tolerance, we sequenced (by duplicate) the genome of both Pleu- and LL-37-evolved strains. For Pleu, we detected in all reads and both replicates only one conserved change corresponding to the deletion of an adenosine (A) nucleotide in an intergenic region containing the promoter for the yejK and yejL genes (Supplementary Table S3). The first gene encodes for radD helicase, while the second gene is uncharacterized. These mutations could explain the increased tolerance to antibiotics of the quinolone family, such as ciprofloxacin and nalidixic acid, involved in the replication of the bacterial genome. We also found other mutations (≥90% in the population) involving several genes related to the ribosome (sspA), glycolate metabolism (glcE), and phospholipid transport in the membrane (mlaC-mlaF, gltP; Supplementary Table S3). The first two types (related to ribosome and glycolate metabolism) could explain the sensitization effect observed against kanamycin. In the first case, because the ribosome is the main target of kanamycin, and in the second because it has been shown that metabolism linked to carbon sources allows bacterial sensitization against amino acids of the aminoglycoside family such as kanamycin [28,29]. For their part, changes at the membrane level, particularly in glycolipid transport (gltP), may result in the asymmetry of lipid composition [30], and thus explains the cross-tolerance observed between Pleu and LL-37. In the LL-37-evolved strain, we also found changes at the genomic level, although not directly related to internal, essential targets. Instead, they were associated with amino acid metabolism (mhpC, valU) and glycolipid transport (gltP), in line with the LL-37 mechanism of action. The absence of significant mutations in the evolved strains may explain the lack of tolerance after LL-37 treatment.

It is worth noting that several genes and pathways involved in AMP tolerance overlap in antibiotic-evolved strains. Specifically, mutations in the sspA gene were also found in antibiotic-tolerant strains [1]. Other mutations, though not shared with antibiotic tolerant strains, are involved in the same biological processes, such as amino acid and protein biosynthesis. Although this does not mean that cells evolved using similar trajectories, it may explain why we observe a cross-tolerance between AMP and antibiotics in certain cases.

4. Discussion

The failure of antibiotic treatments is mainly attributed to the resistance acquired by microorganisms [31]. However, there are other relevant mechanisms including tolerance, that can contribute to therapeutic failure [32]. Tolerance refers to the ability of bacteria to survive the effect of the antimicrobial for longer periods. In antibiotics, tolerance can precede resistance as it allows the cell to survive for the time needed to develop resistance mutations [4]. These mechanisms acquire a special relevance in the case of AMPs, which are produced by the host innate immune cells and represent the first barrier of protection against infections [33]. Neutrophil degranulation, for example, involves the secretion of AMPs that reach high local concentrations in the body [34]. Therefore, ideal circumstances occur for bacterial cells to acquire mutations conferring some tolerance to these AMPs. In this study, we have shown that bacteria can gain tolerance in the presence of high AMP concentrations (~MIC).

This behavior is not identical for all AMPs. Some generated tolerance in early incubation cycles (1–4), while others failed to induce tolerance. While AMPs share some features, they are quite different in terms of sequence and structure. In the present case, all peptides are cationic, with an isoelectric point between 10 and 11, and adopt a helical structure, except PolB which is cyclic. Hence, the increase in tolerance cannot be directly related to structure. Based on our results, we hypothesize that the mechanism of action could explain the observed differences. Thus, both LL-37 and PolB act preferentially on the cell membrane, while Pleu and Derm can inhibit the synthesis of macromolecules, including DNA, RNA, and proteins. The fact that Pleu-tolerant strains have altered sensitivity to kanamycin, ciprofloxacin, and nalidixic acid, but not ampicillin, reinforces the idea of action at the level of cytoplasmic targets. Indeed, the action of both Pleu and Derm is more similar to classic antibiotics such as kanamycin, which would explain their behavior.

The increase in lag phase for tolerant strains suggests that bacteria can achieve tolerance after repeated AMP incubation. The appearance at the first incubation cycle of smaller colonies that are not actually tolerant suggests a two-stage mechanism. Firstly, stress causes a decrease in the metabolic activity of bacteria, which translates into smaller colonies and slower growth. Then, after several cycles of incubation, these changes can be fixed in the genome, generating tolerant strains. In the first few cycles, we observed colonies with reduced growth, probably because of transient heritable phenotypes at the proteome or epigenome level. Then, mutations at the genome level could accumulate in subsequent cycles, generating tolerant strains. This is well illustrated in the case of Derm, where colonies with reduced morphology were observed after the first incubation cycle but did not translate into tolerance, as revealed by the lethality curves. However, from cycle 4 onwards, the lethality curves reflected the appearance of tolerance, suggesting mutations at the genome level.

The mutations observed in LL-37- and Pleu-evolved strains are consistent with the results observed in previous experiments. Some of these mutations were also observed in clinical strains, suggesting that tolerance can also happen in human patients (Supplementary Table S3). It is tempting to speculate that, after the initial innate immune response, bacteria can become tolerant to AMPs. Then, when patients are treated with antibiotics, AMP-tolerant strains may have an advantage in surviving antibiotics. As mutations allow them to survive for longer in the presence of antibiotics, resistance is more likely to occur. The opposite behavior, sensitization to antibiotics, cannot be ruled out in view of our results, as noted by strains tolerant to Pleu, which were more sensible to kanamycin.

In summary, we show that bacteria can generate tolerance against certain AMPs, depending on their mechanism of action. This tolerance can affect the action of other AMPs or even antibiotics used to treat these infections. Hence, the relationship between AMP activity and tolerance deserves further attention. On the one hand, a more comprehensive view of bacterial evolution to AMPs, involving both tolerance and resistance, could be useful when developing novel AMPs. On the other hand, further exploration of the mechanisms of cross-tolerance between antibiotics and AMPs should contribute to a better understanding of how bacteria become resistant to antibiotic treatment.