Linguatula serrata (Fröhlich, 1789) in Gray Wolf (Canis lupus) from Italy: A Neglected Zoonotic Parasite
Abstract
:1. Introduction
2. Materials and Methods
3. Results
4. Discussion
5. Conclusions
Supplementary Materials
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Conflicts of Interest
References
- Riley, J. The Biology of Pentastomids. In Advances in Parasitology; Baker, J.R., Muller, R., Eds.; Academic Press: London, UK, 1986; Volume 25, pp. 45–128. [Google Scholar]
- Christoffersen, M.L.; De Assis, J.E. A systematic monograph of the recent Pentastomida, with a compilation of their hosts. Zool. Meded. 2013, 87, 1–206. [Google Scholar]
- Tabaripour, R.; Shokri, A.; Hosseini Teshnizi, S.; Fakhar, M.; Keighobadi, M. Status of Linguatula serrata infection in livestock: A systematic review with meta-analysis in Iran. Paras. Epid. Cont. 2019, 7, e00111. [Google Scholar] [CrossRef] [PubMed]
- Musharrafıeh, U.; Hamadeh, G.; Touma, A.; Fares, J. Nasopharyngeal linguatulosis or halzoun syndrome: Clinical diagnosis and treatment. Rev. Assoc. Médica Bras. 2018, 64, 1081–1084. [Google Scholar] [CrossRef] [PubMed]
- Tabaripour, R.; Keighobadi, M.; Sharifpour, A.; Azadeh, H.; Shokri, A.; Banimostafavi, E.S.; Fakhar, M.; Abedi, S. Global status of neglected human Linguatula infection: A systematic review of published case reports. Parasitol. Res. 2021, 120, 3045–3050. [Google Scholar] [CrossRef] [PubMed]
- Rezaei, H.; Ashrafihelan, J.; Nematollahi, A.; Mostafavi, E. The prevalence of Linguatula serrata nymphs in goats slaughtered in Tabriz, Iran. J. Parasit Dis. 2012, 36, 200–202. [Google Scholar] [CrossRef] [Green Version]
- Drabick, J.J. Pentastomiasis. Rev. Infect. Dis. 1987, 6, 1087–1094. [Google Scholar] [CrossRef]
- Dryden, M.W.; Payne, P.A.; Ridley, R.; Smith, V. Comparison of common fecal flotation techniques for the recovery of parasite eggs and oocysts. Vet. Ther. 2005, 6, 15–28. [Google Scholar]
- Neveu-Lemaire, M. Traité D’Entomologie Médicale et Vétérinaire; Vigot Frères, Editeurs: Paris, France, 1938; Volume 28, p. 1339. [Google Scholar]
- Folmer, O.; Black, M.; Hoeh, W.; Lutz, R.; Vrijenhoek, R. DNA primers for amplification of mitochondrial cytochrome c oxidase subunit I from diverse metazoan invertebrates. Mol. Mar. Biol. Biotechnol. 1994, 5, 294–299. [Google Scholar]
- Shamsi, S.; Zhu, X.; Halajian, A.; Barton, D.P. 28S rRNA sequences for Linguatula spp. Parasitol. Res. 2022, 6, 1799–1804. [Google Scholar] [CrossRef]
- Tamura, K.; Peterson, D.; Peterson, N.; Masatoshi, G.S.; Kumar, N.S. MEGA5: Molecular Evolutionary Genetics Analysis Using Maximum Likelihood, Evolutionary Distance, and Maximum Parsimony Methods. Mol. Biol. Evol. 2011, 28, 2731–2739. [Google Scholar] [CrossRef] [Green Version]
- Bogdaschew, V.N. Der Zusammenhang der anatomischenformen der metacarpal und metatarsalknochen der haustieremit dem histologischenbau und der chemisch-physikalischeneigenschafternderselben. Anat. Anz. 1930, 70, 113–154. [Google Scholar]
- Tasan, E. Distribution of Linguatula serrata, Frölich, 1789 in dogs from rural districts of Elaziğ. Doğa. Vet. Hay Derg. 1987, 11, 86–89. [Google Scholar]
- Jones, D.A.; Riley, J. An ELISA for the detection of pentatomid infections in the rat. Parasitology 1991, 3, 331–337. [Google Scholar] [CrossRef] [PubMed]
- Mohammadi, M.A.; Bamorovat, M.; Sharifi, I.; Mostafavi, M.; Zarandi, M.B.; Kheirandish, R.; Karamoozian, A.; Khatami, M.; Zadeh, S.H. Linguatula serrata in cattle in southeastern Iran: Epidemiological, histopathological and phylogenetic profile and its zoonotic importance. Vet. Parasitol. Reg. Stud. Rep. 2020, 22, 100465. [Google Scholar] [CrossRef] [PubMed]
- Yazdani, R.; Sharifi, I.; Bamorovat, M.; Mohammadi, M.A.M.A. Human Linguatulosis caused by Linguatula serrata in the City of Kerman, South-eastern Iran- case report. Iran. J. Parasitol. 2014, 9, 282–285. [Google Scholar] [PubMed]
- Islam, R.; Hossain, M.S.; Alam, Z.; Islam, A.; Khan, A.H.N.A.; Kabir, M.E.; Hatta, T.; Alim, A.; Tsuji, N. Linguatula serrata, a food-borne zoonotic parasite, in livestock in Bangladesh: Some pathologic and epidemiologic aspects. Vet. Parasitol. Reg. Stud. Rep. 2018, 13, 135–140. [Google Scholar] [CrossRef] [PubMed]
- Sudan, V.; Jaiswal, A.K.; Shanker, D. Infection rates of Linguatula serrata nymphs in mesenteric lymph nodes from water buffaloes in North India. Vet. Parasitol. 2014, 205, 408–411. [Google Scholar] [CrossRef]
- Hajipour, N.; Tavassoli, M. Prevalence and associated risk factors of Linguatula serrata infection in definitive and intermediate hosts in Iran and other countries: A systematic review. Vet. Parasitol. Reg. Stud. Rep. 2019, 16, 100288. [Google Scholar] [CrossRef]
- Gül, A.; Değer, S.; Denizhan, V. Van Ili Koyunlarinda Linguatula serrata (Fröhlich, 1789) NimflerininYayginliği [The prevalence of Linguatula serrata (Fröhlich, 1789) nymphs in sheep in the Van province]. Turk. Parazitol. Derg. 2009, 33, 25–27. [Google Scholar]
- Gothe, R.; Barutzki, D.; Schöl, H.; Heinen, H. Importierte Infestationen nasopharyngealer Parasiten beim Hund [Imported infestations of nasopharyngeal parasites in dogs]. Tierarztl. Prax. 1991, 19, 84–87. [Google Scholar]
- Thomas, M. Linguatula serrata in an imported Romanian street dog. Vet. Rec. 2018, 182, 112–113. [Google Scholar] [CrossRef] [PubMed]
- Mitchell, S.; Bell, S.; Wright, I.; Wall, R.; Jeckel, S.; Blake, D.; Marshall, P.; Andrews, C.; Lee, M.; Walsh, A. Tongue worm (Linguatula species) in stray dogs imported into the UK. Vet. Rec. 2016, 179, 259–260. [Google Scholar] [CrossRef] [PubMed]
- Ioniță, M.; Mitrea, I.L. Linguatula serrata (Pentastomida: Linguatulidae) infection in dog, Romania: A case report. AgroLife Sci. J. 2016, 5, 85–89. [Google Scholar]
- Ferenc, C.; Pavlović, I.; Tamas, C.; Lengyel, B. Occurrence of Linguatula serrata in dogs in Nagybecskerek. A case study. KisallatPraxis 2014, 15, 64–67. [Google Scholar]
- Bordicchia, M.; Falcioni, D.; Scarpona, S.; Rossi, G. Nasal carcinoma in a dog with Linguatula serrata infection. Vet. Rec. Case Rep. 2014, 2, e000015. [Google Scholar] [CrossRef]
- Principato, M.; Polidori, G.A.; Dacomo, F.; Giannetto, S. Nasal pentastomiasis in dogs by Linguatula serrata Frohlich 1789: Notes on its very high biological potentiality. Parassitologia 1994, 36, 119. [Google Scholar]
- Cafiero, M.A.; Cavaliere, N.; Lia, R. Linguatula serrata, Frohlich, 1789 in a dog in Apulia region. In Proceedings of the 51th Congresso Nazionale S.I.S.Vet, Bologna, Italy, 17–20 September 1997; pp. 617–618. [Google Scholar]
- Pavlović, I.; Penezić, A.; Ćosić, N.; Burazerović, J.; Maletić, V.; Ćirović, D. The first report of Linguatula serrata in grey wolf (Canis lupus) from Central Balkans. J. Hellenic. Vet. Med. Soc. 2017, 68, 687–690. [Google Scholar] [CrossRef]
- Sinclair, K.B. The incidence and life cycle of Linguatula serrata (Frohlich 1789) in Great Britain. J. Comp. Pathol. 1954, 64, 371–383. [Google Scholar] [CrossRef]
- Dorchies, P.; De Lahitte, D.J.; Pangui, L.J.; Alzieu, J.P. Recherche de Fasciola hepatica, Dicrocoeliumlanceolatum et Linguatula denticulate dans les foies de bovinssaisis (a) l’abattoire de Pamiers. Revue Méd. Vét. 1988, 39, 307–309. [Google Scholar]
- Bertolini, G. Un caso di Pentastomatenioide in una pecora. Giorn. Vet. Mil. 1892, 5, 352–355. [Google Scholar]
- Tessé, G. Frequentissimi casi di Linguatula denticulata nei gangli mesenterici dei bovini sardi. Clin. Vet. 1913, 36, 147–157. [Google Scholar]
- Pampiglione, S.; Rivasi, F.; Villani, G. Linguatula serrata: Un caso umano con manifestazioni pseudoappendicolari, nel Molise (Italia Centrale). Parassitologia 1998, 40, 124. [Google Scholar]
- Pampiglione, S.; Gentile, A.; Maggi, P.; Scattone, A.; Sollitto, F. A nodularpulmonarylesion due to Linguatula serrata in an HIV-positive man. Parassitologia 2001, 43, 105–108. [Google Scholar] [PubMed]
- Parenzan, P.; Chieffi, G. Primo caso clinico di infestazione umana da Linguatula serrata in Italia [First clinical case of human infestation from Linguatula serrata in Italy]. Acta Med. Ital. 1951, 6, 67–69. [Google Scholar] [PubMed]
- Koehsler, M.; Walochnik, J.; Georgopoulos, M.; Pruente, C.; Boeckeler, W.; Auer, H.; Barisani-Asenbauer, T. Linguatula serrata Tongue Worm in Human Eye, Austria. Emerg. Infec. Dis. 2011, 17, 870–872. [Google Scholar] [CrossRef]
- Gjerde, B. Phylogenetic position of Linguatulaarctica and Linguatula serrata (Pentastomida) as inferred from the nuclear 18S rRNA gene and the mitochondrial cytochrome c oxidase subunit I gene. Parasitol. Res. 2013, 112, 3517–3525. [Google Scholar] [CrossRef]
- Ghorashi, S.A.; Tavassoli, M.; Peters, A.; Shamsi, S.; Hajipour, N. Phylogenetic relationships among Linguatula serrata isolates from Iran based on 18S rRNA and mitochondrial cox1 gene sequences. Acta Parasitol. 2016, 61, 195–200. [Google Scholar] [CrossRef]
GenBank Accession Number/Species | Country | Host | % Homology |
---|---|---|---|
MW947492/L. serrata * | Italy | Wolf | 100% |
MZ052082/L. serrata | Italy | Dog | 100% |
LC150783/L. serrata | Bangladesh | Cattle | 99.83% |
KF830141/L. serrata | Iran | Camel | 99.50% |
LC150782/L. serrata | Bangladesh | Cattle | 99.83% |
KY829107/L. serrata | Peru | Camel | 99.67% |
KY829108/L. serrata | Peru | Camel | 99.67% |
KY829109/L. serrata | Peru | Camel | 99.67% |
KF830139/L. serrata | Iran | Dog | 99.00% |
LC150781/L. serrata | Bangladesh | Cattle | 99.83% |
KU234193/L. serrata | Iran | Sheep | 99.52% |
KF029447/L. serrata | Norway | Dog | 100% |
KF830138/L. serrata | Iran | Sheep | 99.50% |
KF830137/L. serrata | Iran | Cattle | 98.00% |
KF029443/L. arctica # | Norway | Reindeer | 89.95% |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2022 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Raele, D.A.; Petrella, A.; Troiano, P.; Cafiero, M.A. Linguatula serrata (Fröhlich, 1789) in Gray Wolf (Canis lupus) from Italy: A Neglected Zoonotic Parasite. Pathogens 2022, 11, 1523. https://doi.org/10.3390/pathogens11121523
Raele DA, Petrella A, Troiano P, Cafiero MA. Linguatula serrata (Fröhlich, 1789) in Gray Wolf (Canis lupus) from Italy: A Neglected Zoonotic Parasite. Pathogens. 2022; 11(12):1523. https://doi.org/10.3390/pathogens11121523
Chicago/Turabian StyleRaele, Donato Antonio, Antonio Petrella, Pasquale Troiano, and Maria Assunta Cafiero. 2022. "Linguatula serrata (Fröhlich, 1789) in Gray Wolf (Canis lupus) from Italy: A Neglected Zoonotic Parasite" Pathogens 11, no. 12: 1523. https://doi.org/10.3390/pathogens11121523
APA StyleRaele, D. A., Petrella, A., Troiano, P., & Cafiero, M. A. (2022). Linguatula serrata (Fröhlich, 1789) in Gray Wolf (Canis lupus) from Italy: A Neglected Zoonotic Parasite. Pathogens, 11(12), 1523. https://doi.org/10.3390/pathogens11121523