Next Article in Journal
Comparative Analysis of Blood MMP-9 Concentration in Alcohol- and Opioid-Addicted Patients
Previous Article in Journal
The Association Between Childhood Experience of Living with a Heavy Drinker and Self-Rated Mental Health in the Adult General Population
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Case Report

Pseudohypertriglyceridemia in a Patient with Pancreatitis Without Evidence for Glycerol Kinase Deficiency: A Rare Case Report and Review of the Literature

1
Department of Pharmacy, Sir Run Run Shaw Hospital, School of Medicine, Zhejiang University, Hangzhou 310016, China
2
Department of Pharmacy, Haiyan People’s Hospital, Jiaxing 314399, China
*
Author to whom correspondence should be addressed.
Diseases 2025, 13(2), 29; https://doi.org/10.3390/diseases13020029
Submission received: 24 December 2024 / Revised: 20 January 2025 / Accepted: 22 January 2025 / Published: 23 January 2025

Abstract

:
Background: Pseudohypertriglyceridemia (pseudo-HTG) is a condition in patients with glycerol kinase deficiency or other disorders of glycerol metabolism, as well as in individuals with alcoholism, severe liver disease, or metabolic disturbances, and those receiving heparin therapy. Exogenous glycerol intake can also trigger this condition. However, the causes of pseudo-HTG are poorly understood, and a clinical algorithm for its diagnosing remains to be developed. Case presentation: We present the case of a 46-year-old man admitted to hospital with hypertriglyceridemia-induced severe acute pancreatitis (HTG-SAP) and type 2 diabetes mellitus. Upon admission, his plasma triglyceride (TG) level was critically high at 43.78 mmol/L (3877 mg/dL). During hospitalization, he developed acute renal insufficiency and diabetic ketoacidosis (DKA). Despite conventional lipid-lowering treatments, including extracorporeal lipoprotein apheresis, his TG levels remained elevated. The unusually clear serum led to suspicion of pseudo-HTG. A glycerol-corrected TG assay confirmed normal TG values, thereby diagnosing pseudo-HTG. Conclusions: This report presents the first confirmed case of pseudo-HTG verified through definitive glycerol kinase (GK) gene testing in a patient without glycerol kinase deficiency. We also include a review of the relevant literature and propose a clinical algorithm. The case report highlights the importance of considering pseudo-HTG in hypertriglyceridemia patients who do not respond well to the standard TG-lowering treatment. Our proposed clinical algorithm for diagnosing pseudo-HTG is potentially invaluable in clinical practice, and helps to prevent unnecessary lipid-lowering treatments for patients with pseudo-HTG.

1. Introduction

Pseudohypertriglyceridemia (pseudo-HTG) is caused by high plasma glycerol levels that interfere with triglyceride (TG) measurements, and patients with this condition do not respond well to conventional lipid-lowering treatments. The true prevalence of pseudo-HTG remains uncertain, as identifying the actual rate is difficult due to the presence of asymptomatic cases. Discrepancies are observed between measured triglyceride levels and patients’ clinical manifestations, prompting an investigation into potential interfering factors [1]. The key to diagnosing pseudo-HTG is to test the TG levels using a glycerol-blanking assay, which emphasizes the need for clinicians to be aware of the condition [1]. However, the glycerol-blanking assay is not routinely implemented, leading to potential misdiagnosis.
The main causes of pseudo-HTG include glycerol kinase deficiency (GKD), metabolic disorders, severe liver diseases, and excessive glycerol intake [1,2], which can be categorized into endogenous and exogenous factors. Specifically, glycerol metabolism disorders, GKD, metabolic disorders, hyperthyroidism, and severe hepatic impairment constitute the endogenous factors [3,4]. Mutational analysis of GK genes can be considered for a definitive diagnosis of GKD. Although not routinely performed in clinical practice, genetic analysis may serve as an effective diagnostic tool, especially as testing becomes more widely available. In contrast, the intake of glycerol-containing medications, heparin therapy, or consumption of certain alcoholic beverages containing glycerol as an ingredient represents the exogenous factors [4,5]. Patients with pseudo-HTG often display clinical features such as increased TG levels in men, clear serum samples, decreased effectiveness of TG-lowering therapies, impaired glucose homeostasis or insulin resistance, and the absence of other metabolic syndrome features [3,4].
Herein, we report a case of pseudo-HTG secondary to severe acute pancreatitis (SAP), accompanied by severe renal insufficiency and DKA during hospitalization. Furthermore, we discuss the possible causes that led to pseudo-HTG in the present case and propose a clinical algorithm for diagnosing pseudo-HTG.

2. Detailed Case Description

The patient, a 46-year-old man, was admitted to Sir Run Run Shaw Hospital after recurrent episodes of abdominal pain lasting for two years, which had worsened for more than half a month. The patient denied consuming or abusing alcohol and was diagnosed as having hypertriglyceridemia-induced severe acute pancreatitis (HTG-SAP), along with abdominal bleeding, abdominal infection, and stage 3 acute kidney injury. The patient was diagnosed with acute pancreatitis two years ago, and following symptomatic treatment, his abdominal pain was significantly relieved. In addition, the patient had type 2 diabetes mellitus (T2DM) for one year, for which he took oral metformin, and he presented with good glycemic control. Furthermore, his thyroid function test results were normal.
At onset, the patient initially presented with severe upper abdominal pain that was persistent and radiated to the lower back without any obvious cause. Upon evaluation, it was found that the patient had an extremely high TG level of 43.78 mmol/L (3877 mg/dL). Furthermore, his serum lipase level was unusually high (821 U/L) (reference interval: <79 U/L). A CT scan showed diffuse enlargement of the pancreas with unclear boundaries, multiple low-density necrotic areas within the parenchyma, obscured peripancreatic fat spaces, along with a large amount of peripancreatic and abdominal fluid, indicating severe acute pancreatitis. The patient was administered a regimen at Lishui People’s Hospital, including pantoprazole to suppress acid, ustekinumab for anti-inflammatory effects, and octreotide to suppress pancreatic fluid secretion. However, on the second day after admission, the patient’s renal function deteriorated with an additional symptom of notable abdominal distension. Therefore, he was transferred to the intensive care unit for treatments including gastric decompression, plasmapheresis, continuous renal replacement therapy (CRRT), enema, and anti-infection therapy. Furthermore, a lipid-lowering treatment was administered, combining intravenous insulin at 0.3 units/kg/hour with low-molecular-weight heparin 5000 iu twice daily. Following five rounds of plasmapheresis, the patient’s TG level gradually decreased to 14.59 mmol/L (1292 mg/dL), and he was transferred to the general ward for further treatment. Despite this improvement, half a month later, the patient started showing the symptom of bilious vomiting, accompanied by distinct abdominal distension. A re-examination CT revealed that the patient’s acute pancreatitis had progressed, which prompted his transfer to our hospital.
By the time the patient was transferred to Sir Run Run Shaw Hospital, his TG level was 26.59 mmol/L (2355 mg/dL) and he was treated with extracorporeal lipoprotein apheresis. Since hospitalization, the patient had been fasting due to gastric decompression. On the 18th day after the onset of the disease, he was transferred to our hospital for treatment, at which point, his TG level increased to 30.31 mmol/L (2685 mg/dL), indicating that the previous treatment was not effective. The patient developed DKA, as evidenced by laboratory tests that showed an elevated blood glucose level of up to 20.0 mmol/L, beta-hydroxybutyrate level of 6.67 mmol/L (reference interval: 0.02–0.27 mmol/L), and a HCO3¯ level of 10.40 mmol/L (reference interval: 26–32 mmol/L). Subsequently, CRRT was administered, resulting in a decrease in the TG level to 18.96 mmol/L (1679 mg/dL), as observed on day 19. On day 20, his TG level again increased to 29.18 mmol/L (2584 mg/dL). Although ketoacidosis was corrected within 4 days of treatment, the TG level could be reduced only slightly to 22.85 mmol/L (2024 mg/dL). Interestingly, the patient’s plasma was clear, and his low-density lipoprotein cholesterol (LDL-C) level was notably lower (Table 1). Hence, the patient was suspected of having pseudo-HTG. To confirm the diagnosis of GKD, sequencing was performed on the specific region of the glycerate kinase (GK) gene, located at locus Xp21.3 of the X chromosome and encompassing 21 exons; however, the results were negative. Subsequently, the patient’s glycerol-blanked TG levels were tested, which were found to be 2.54 mmol/L (225 mg/dL), a value that was close to the normal range. Thus, the difference between these two values, which was 20.31 mmol/L (187 mg/dL), was considered to denote the patient’s serum glycerol level. Consequently, lipid-lowering therapy was discontinued, and the patient was transferred to the general ward. The trend of changes in his TG levels was evaluated in a reference laboratory (Figure 1). The patient recovered successfully, with no recurrence of pancreatitis during the 1-year follow-up period.

3. Discussion

To date, there have been limited studies reporting pseudo-HTG without evidence for GKD [4]. From 1995 to 2024, only a few studies on pseudo-HTG without evidence for glycerol kinase deficiency have been published and are summarized in Table 2 [4,5,6,7,8,9,10,11]. Among those ten patients previously described in the literature, eight (80%) of them were male and nine (90%) of them were over 40 years old. Common clinical features reported in these cases include male gender, HTG unresponsive to multiple lipid-lowering therapies, normal TG levels before onset, exogenous glycerol intake with or without impaired renal function, and clear serum samples. Additional clinical features include a normal body mass index (BMI) and inconsistent lipid profiles (normal cholesterol and high-density lipoprotein, etc.). Impaired glucose homeostasis has also been observed in individual cases. The age of onset in our cases is over 40 years old, with a medical history including pancreatitis, acute severe renal impairment, DKA, high BMI, and inconsistent lipid profiles. Moreover, the serum sample obtained from the patient appeared clear, and was consistent with the cases reported in the literature. However, none of the reported cases had been genetically tested for GKD. Given the varied clinical characteristics of GKD patients, genetic testing is vital for diagnosing GKD. Moreover, the underlying cause directly determines the subsequent treatment strategy. Our case is the first in which genetic testing for GKD was performed and GKD was definitively excluded.
Given the difficulties in diagnosing pseudo-HTG, we present a clinical algorithm in Figure 2, which can be used as a diagnostic aid in suspected cases. In HTG-SAP, therapeutic measures include insulin and/or heparin therapy, dietary changes, and other antihyperlipidemic medications [12]. Insulin increases the activity of lipoprotein lipase (LPL), which speeds up the breakdown of chylomicrons and lowers TG levels [13,14]. Heparin lowers the levels of TGs by releasing lipoprotein lipase that was originally stored in the endothelial cell [15]. In addition to these treatments, the patient was also treated with plasmapheresis as an emergency method of lowering TGs. However, in the present case, significant outcomes could not be achieved, and the patient’s TG level remained persistently high. Moreover, blood samples of patients with TG levels higher than 11.29 mmol/L (1000 mg/dL) may appear lipemic [16]. However, unlike the cloudy or celiac serum typically seen in true HTG cases, in the present case, the patient’s serum was clear. The glycerol-blanking procedure involves the enzymatic catalysis of free glycerol prior to TG hydrolysis [17]. During the glycerol-blanking procedure, the difference between the noncorrected and glycerol-corrected TG values indicates the concentration of free glycerol. Interestingly, the observed celiac serum at the beginning of the patient’s admission to the first hospital was different from the current presentation. The patient showed a true elevation in TG levels at the onset of pancreatitis.
To determine the etiology of pseudo-HTG, we investigated endogenous factors including GKD and the patient’s comorbidities. The most common cause of pseudo-HTG is GKD. GKD is a rare genetic disorder characterized by hyperglyceridemia and glycosuria, which are caused by the deletion or mutation of the GK gene [18]. GK catalyzes the phosphorylation of glycerol-to-glycerol-3-phosphate and plays a crucial role in glycerol metabolism and TG formation [19]. Most patients with GKD-induced pseudo-HTG show a normal body mass index (BMI) but increased TG levels (<11.29 mmol/L) [1]. However, the patient in the present study had a BMI of 33.12 kg/m2 and a consistently high TG level of >11.29 mmol/L, which did not align entirely with the clinical profile of GKD. Additionally, genetic testing ruled out mutations in the GK gene.
DKA may be an endogenous cause of pseudo-HTG, which cannot be excluded in the present case. There have been case reports indicating that diabetic ketoacidosis might result in HTG [20,21]. In cases of DKA with severe insulin deficiency, the elevated counterregulatory hormone triggers the activation of hormone-sensitive lipase in adipose tissue. This activation leads to the release of large amounts of glycerol and free fatty acids (FFAs) into the circulation when hormone-sensitive lipase lipolyzes endogenous TGs [22,23]. Free glycerol primarily comes from the lipolysis process in adipose tissue, indicating the mobilization of fat within the body. Under these circumstances, there is a significant increase in plasma free glycerol. Consequently, the excessive release of endogenous glycerol affects the accuracy of true TG measurement results.
In addition to DKA, severely impaired kidney function is also a potential endogenous factor contributing to pseudo-HTG. The patient also experienced renal insufficiency similar to a previously reported case [7], exhibiting acute renal failure with a decreased glomerular filtration rate of 11.29 mL/min/1.73 m2, which interfered with the normal excretion of glycerol. Research has demonstrated that the urinary excretion of glycerol commences when the blood glycerol concentration exceeds 1.6 mmol/L [24]. Furthermore, at blood glycerol concentrations ranging from 15 to 20 mmol/L, glycerol is predominantly excreted through urine [24]. However, due to the patient’s impaired renal function, glycerol could not be excreted completely through the urine.
The role of heparin cannot be ignored when considering exogenous factors leading to pseudohyperlipidemia. Heparin’s impact on TG metabolism is indeed a double-edged sword. Heparin can stimulate the release of lipoprotein lipase (LPL), enhancing its activity. This process accelerates the breakdown of chylomicrons and very-low-density lipoproteins (VLDL), thereby reducing the TG levels. However, according to a case study, a pregnant lady who used heparin for a long time acquired HTG-AP [25]. Research suggests that the serum TG level can rise again after a prolonged heparin infusion because heparin can reduce LPL on the surface of endothelial cells [26,27].
Exogenous glycerol comes from certain alcoholic beverages, pharmaceuticals, cosmetics (like lotions), cleaning supplies (such as soap and detergents), and parenteral nutrition. For this patient, there was neither alcohol intake nor parenteral nutrition. The only drug that the patient used that contained glycerol as an excipient was insulin. Glycerol is used as an excipient in certain insulin formulations to aid in stabilizing the medication and regulating its osmotic pressure. Specifically, this insulin solution generally contains 1.4 to 1.8 g of glycerol per 100 mL. During hospitalization in the first hospital, the patient consumed 23 bottles of insulin (400 IU, 10 mL/bottle, Wanbang Pharmaceutical Company, Xuzhou, China) in 15 days, containing 3.22–4.14 g of glycerol. This equates to a daily consumption of approximately 215–276 mg of glycerol. It has been established that a variation of ±1 mg/dL in the free glycerol concentration corresponds to a fluctuation of ±10 mg/dL in TG levels [1]. The intravenous administration of glycerol in the patient exceeded the oral intake documented in a previous case report [28]. The glycerol content in insulin among patients with renal insufficiency may not be overlooked. The patient’s exposure to glycerol through insulin formulations highlights the need to consider exogenous sources in pseudo-HTG cases.
This diagnostic algorithm is carefully crafted to determine the root cause of HTG using a methodical approach. The process begins with administering triglyceride-lowering treatments. If the patient responds well, it points to primary HTG. However, if these treatments do not work, further testing with glycerol-blanked triglyceride measurements is necessary. A normal result from this test suggests pseudo-HTG, which can be attributed to internal factors or external factors. Conversely, if the triglyceride levels stay high, secondary HTG, possibly due to severe illness or liver disease, is considered. This methodical approach facilitates precise diagnosis and allows for the efficient treatment of HTG.
Given its rarity and potential for underdiagnosis, the early detection of pseudo-HTG is crucial to avoid unnecessary tests and treatments. The patient’s TG level was determined using the glycerol-phosphoric acid oxidase peroxidase (GPO-POD) assay kit (Beckman Coulter Company, Suzhou, China). The TG method involves a series of coupled enzymatic reactions. In this method, TG in the sample is hydrolyzed by LPL to form glycerol and FFAs. Like the majority of TG tests conducted in clinical laboratories, the enzymatic analysis of TGs can be affected by glycerol interference. Without the implementation of a blanking procedure, an elevated level of free glycerol in a sample inevitably results in an increase in the measured TG level. The concentration of free glycerol is measured by the difference between the noncorrected and glycerol-corrected TG values. Thus, we used this procedure to determine the patient’s glycerol concentration, accounting for glycerol interference to compare the uncorrected and corrected findings for TG levels. In most cases, a glycerol-blanked TG assay is not clinically used as it involves unnecessary expenses; however, it is essential for patients suspected of having pseudo-HTG.

4. Conclusions

We present a rare case of pseudo-HTG without evidence of glycerol kinase deficiency. This case highlights the importance of considering pseudo-HTG among patients with clear serum samples who do not respond to conventional lipid-lowering therapy. Specifically, if patients also have metabolic disorders or renal insufficiency, as well as abnormally high TG levels and mismatched VLDL levels, the possibility of pseudo-HTG should be further evaluated. Diagnosing pseudo-HTG can be challenging because standard TG assays cannot determine the impact of free glycerol levels. In suspected cases of pseudo-HTG, we recommend using the glycerol-blanking procedure to determine the concentration of TGs and free glycerol. The timely identification of pseudo-HTG is critical for avoiding unwarranted medication and the potential overestimation of cardiovascular risks.

Author Contributions

J.Z. collected and analyzed the data and drafted and revised the manuscript. C.Z. contributed to the data analysis and manuscript editing and revision. R.Z. provided guidance on the conceptualization of the study and reviewed and edited the manuscript. All authors have read and agreed to the published version of the manuscript.

Funding

This work was supported by the Zhejiang Provincial Natural Science Foundation of China [grant number LYY20H31000].

Institutional Review Board Statement

The study was conducted in accordance with the Declaration of Helsinki, and approved by the the Ethics Committee of Sir Run Run Shaw Hospital, School of Medicine, Zhejiang University (reference number 2023-0234 and date of approval: 2023-02-03)

Informed Consent Statement

Written informed consent was obtained from the patient for publication of this case report. A copy of the written consent is available for review by the editor of this journal.

Data Availability Statement

All data analyzed during this study are included within the article.

Conflicts of Interest

The authors declare that they have no competing interests.

Abbreviations

pseudo-HTGPseudohypertriglyceridemia
TGtriglyceride
GKDglycerol kinase deficiency
DKAdiabetic ketoacidosis
LPLlipoprotein lipase
GKglycerate kinase
VLDLvery-low-density lipoprotein
GPO-PODglycerol-phosphoric acid oxidase peroxidase

References

  1. Backes, J.M.; Dayspring, T.D.; Hoefner, D.M.; Contois, J.H.; McConnell, J.P.; Moriarty, P.M. Identifying pseudohypertriglyceridemia in clinical practice. Clin. Lipidol. 2014, 9, 625–641. [Google Scholar] [CrossRef]
  2. Fu, X.; Williamson, C.P.; Bosfield, K. Pseudo-hypertriglyceridemia in a 2-year-old male with global developmental delay, myopathy and adrenal hypoplasia. J. Mass. Spectrom. Adv. Clin. Lab. 2024, 32, 47–49. [Google Scholar] [CrossRef]
  3. Lamiquiz-Moneo, I.; Mateo-Gallego, R.; Fernandez-Pardo, J.; Lopez-Arino, C.; Marco-Benedi, V.; Bea, A.M.; Ferraro, L.; Jarauta, E.; Cenarro, A.; Civeira, F. Glycerol kinase deficiency in adults: Description of 4 novel cases, systematic review and development of a clinical diagnostic score. Atherosclerosis 2020, 315, 24–32. [Google Scholar] [CrossRef]
  4. Farooq, A.; Treml, A.; Colon-Franco, J.M. A Woman with Pancreatitis and Hypertriglyceridemia. Clin. Chem. 2019, 65, 1216–1218. [Google Scholar] [CrossRef]
  5. Rajagopal, R.; Srinivasan, M. Oral Glycerol Ingestion Causes Pseudohypertriglyceridemia. Am. J. Med. 2017, 130, e543–e544. [Google Scholar] [CrossRef]
  6. Nauck, M.; Winkler, K.; Siekmeier, R.; Marangos, N.; Richter, B.; Marz, W.; Wieland, H. Pseudo-pseudohypertriglyceridemia: A case of increased free glycerol without evidence for glycerol kinase deficiency. Clin. Chem. 1995, 41, 619–620. [Google Scholar] [CrossRef]
  7. Speeckaert, M.M.; Segers, H.; Van Biesen, W.; Verstraete, A.; Langlois, M.R.; Delanghe, J.R. An unusual case of (pseudo)hypertriglyceridaemia. NDT Plus 2010, 3, 570–572. [Google Scholar] [CrossRef]
  8. Backes, J.M.; Dayspring, T.; Mieras, T.; Moriarty, P.M. Pseudohypertriglyceridemia: Two cases of probable glycerol kinase deficiency. J. Clin. Lipidol. 2012, 6, 469–473. [Google Scholar] [CrossRef]
  9. Arrobas-Velilla, T.; Mondejar-Garcia, R.; Gomez-Gerique, J.A.; Canizares Diaz, I.; Cruz Mengibar, M.C.; Orive de Diego, A.; Fabiani-Romero, F. Pseudo-hypertriglyceridaemia or hyperglycerolemia? Clin. Investig. Arterioscler. 2013, 25, 123–126. [Google Scholar] [CrossRef]
  10. Backes, J.M.; Dayspring, T.; Moriarty, P.M. Pseudohypertriglyceridemia-verifying the hypertriglyceridemic patient. J. Clin. Lipidol. 2013, 7, 182–183. [Google Scholar] [CrossRef]
  11. Backes, J.M.; Dayspring, T.D.; Hoefner, D.M.; Moriarty, P.M. Hypertriglyceridaemia unresponsive to multiple treatments. BMJ Case Rep. 2015, 2015, bcr2015210788. [Google Scholar] [CrossRef]
  12. Arranz, N.; Fernandez, S.; Bastida, C. Use of insulin and heparin in the management of severe hypertriglyceridemia in a critically ill patient. Med. Clin. 2022, 159, e81–e82. [Google Scholar] [CrossRef]
  13. Coskun, A.; Erkan, N.; Yakan, S.; Yildirim, M.; Carti, E.; Ucar, D.; Oymaci, E. Treatment of hypertriglyceridemia-induced acute pancreatitis with insulin. Prz. Gastroenterol. 2015, 10, 18–22. [Google Scholar] [CrossRef]
  14. Valdivielso, P.; Ramirez-Bueno, A.; Ewald, N. Current knowledge of hypertriglyceridemic pancreatitis. Eur. J. Intern. Med. 2014, 25, 689–694. [Google Scholar] [CrossRef]
  15. Jain, P.; Rai, R.R.; Udawat, H.; Nijhawan, S.; Mathur, A. Insulin and heparin in treatment of hypertriglyceridemia-induced pancreatitis. World J. Gastroenterol. 2007, 13, 2642–2643. [Google Scholar] [CrossRef]
  16. Ahern, B.J.; Yi, H.J.; Somma, C.L. Hypertriglyceridemia-Induced Pancreatitis and a Lipemic Blood Sample: A Case Report and Brief Clinical Review. J. Emerg. Nurs. 2022, 48, 455–459. [Google Scholar] [CrossRef]
  17. van Heerden, C.; Magwete, A.; Mabuza, D. Evaluating the need for free glycerol blanking for serum triglyceride measurements at Charlotte Maxeke Johannesburg Academic Hospital. Clin. Chem. Lab. Med. 2020, 58, 1257–1264. [Google Scholar] [CrossRef]
  18. Swanson, M.A.; Garcia, S.M.; Spector, E.; Kronquist, K.; Creadon-Swindell, G.; Walter, M.; Christensen, E.; Van Hove, J.L.K.; Sass, J.O. d-Glyceric aciduria does not cause nonketotic hyperglycinemia: A historic co-occurrence. Mol. Genet. Metab. 2017, 121, 80–82. [Google Scholar] [CrossRef]
  19. Sambeat, A.; Ratajczak, J.; Joffraud, M.; Sanchez-Garcia, J.L.; Giner, M.P.; Valsesia, A.; Giroud-Gerbetant, J.; Valera-Alberni, M.; Cercillieux, A.; Boutant, M.; et al. Endogenous nicotinamide riboside metabolism protects against diet-induced liver damage. Nat. Commun. 2019, 10, 4291. [Google Scholar] [CrossRef]
  20. Singla, A.A.; Ting, F.; Singla, A. Acute pancreatitis secondary to diabetic ketoacidosis induced hypertriglyceridemia in a young adult with undiagnosed type 2 diabetes. JOP 2015, 16, 201–204. [Google Scholar] [CrossRef]
  21. Nair, S.; Pitchumoni, C.S. Diabetic ketoacidosis, hyperlipidemia, and acute pancreatitis: The enigmatic triangle. Am. J. Gastroenterol. 1997, 92, 1560–1561. [Google Scholar]
  22. McGarry, J.D.; Woeltje, K.F.; Kuwajima, M.; Foster, D.W. Regulation of ketogenesis and the renaissance of carnitine palmitoyltransferase. Diabetes Metab. Rev. 1989, 5, 271–284. [Google Scholar] [CrossRef]
  23. Dhatariya, K.K.; Glaser, N.S.; Codner, E.; Umpierrez, G.E. Diabetic ketoacidosis. Nat. Rev. Dis. Primers 2020, 6, 40. [Google Scholar] [CrossRef]
  24. Robergs, R.A.; Griffin, S.E. Glycerol. Biochemistry, pharmacokinetics and clinical and practical applications. Sports Med. 1998, 26, 145–167. [Google Scholar] [CrossRef]
  25. Al Riyami, N.B.; Frohlich, J. Extreme hypertriglyceridemia following intravenous heparin infusion. Clin. Biochem. 2008, 41, 907–909. [Google Scholar] [CrossRef]
  26. Guo, Y.Y.; Li, H.X.; Zhang, Y.; He, W.H. Hypertriglyceridemia-induced acute pancreatitis: Progress on disease mechanisms and treatment modalities. Discov. Med. 2019, 27, 101–109. [Google Scholar]
  27. Nasstrom, B.; Stegmayr, B.G.; Olivecrona, G.; Olivecrona, T. Lower plasma levels of lipoprotein lipase after infusion of low molecular weight heparin than after administration of conventional heparin indicate more rapid catabolism of the enzyme. J. Lab. Clin. Med. 2003, 142, 90–99. [Google Scholar] [CrossRef]
  28. Charoenhirunyingyos, W.; Vannasaeng, S. Pseudohypertriglyceridemia from oral glycerine. J. Med. Assoc. Thai 2010, 93, 870–872. [Google Scholar]
Figure 1. The changing trend in serum triglyceride levels. The arrows indicate the lipid-lowering treatment and the time points of the glycerol-corrected triglyceride assay. Abbreviation: CRRT, continuous renal replacement therapy.
Figure 1. The changing trend in serum triglyceride levels. The arrows indicate the lipid-lowering treatment and the time points of the glycerol-corrected triglyceride assay. Abbreviation: CRRT, continuous renal replacement therapy.
Diseases 13 00029 g001
Figure 2. Clinical algorithm for pseudo-HTG diagnosis in suspected cases. Patients with pseudo-HTG do not respond well to standard lipid-lowering therapies. Evaluation of glycerol-blanked triglyceride levels helps to confirm the diagnosis of pseudo-HTG in such cases. Once the diagnosis is confirmed, both endogenous and exogenous causes must be identified. Abbreviations: HTG, hypertriglyceridemia; TG: triglyceride; GKD, glycerol kinase deficiency; DKA, diabetic ketoacidosis.
Figure 2. Clinical algorithm for pseudo-HTG diagnosis in suspected cases. Patients with pseudo-HTG do not respond well to standard lipid-lowering therapies. Evaluation of glycerol-blanked triglyceride levels helps to confirm the diagnosis of pseudo-HTG in such cases. Once the diagnosis is confirmed, both endogenous and exogenous causes must be identified. Abbreviations: HTG, hypertriglyceridemia; TG: triglyceride; GKD, glycerol kinase deficiency; DKA, diabetic ketoacidosis.
Diseases 13 00029 g002
Table 1. Lipid measurements on day 18.
Table 1. Lipid measurements on day 18.
ParameterValueReference Range
TG (GPO-POD)22.85 mmol/L (928.86 mg/dL)<1.70 mmol/L (69.11 mg/dL)
TG (glycerol-corrected)2.54 mmol/L (103.25 mg/dL)/
Glycerol, calculated20.31 mmol/L (785.18 mg/dL)/
VLDL-C (TG/5)4.57 mmol/L (203.25 mg/dL)/
LDL-C0.97 mmol/L (37.51 mg/dL)1.89–4.21 mmol/L (73.09–162.80 mg/dL)
HDL-C0.68 mmol/L (26.29 mg/dL)1.02–1.55 mmol/L (39.44–59.94 mg/dL)
Cholesterol1.80 mmol/L (69.61 mg/dL)3.00–5.70 mmol/L (171.6–326.04 mg/dL)
TG: triglyceride; VLDL-C: very-low-density lipoprotein cholesterol; LDL-C: low-density lipoprotein cholesterol; HDL-C: high-density lipoprotein cholesterol.
Table 2. Literature review of published pseudo-HTG cases that lack evidence of GKD.
Table 2. Literature review of published pseudo-HTG cases that lack evidence of GKD.
AuthorsYearAge/SexBMI (kg/m2) Medical HistoryFamily History of HTGAlcohol Use/AbuseClinical CharacteristicsTG Level (mg/dL)G-C TG Level (mg/dL)Glycerol Level (mg/dL)Serum Sample
Nauck M et al. [6]199543/MNAa loss of hearing of the left ear; hypertensionNANoHTG with little response to therapy; healthy2398NA158clear
Speeckaert MM et al. [7]201057/MNAESRD; autosomal dominant polycystic kidney diseaseNo4 drinks weeklyintake of glycerol-containing beer; a reduced glycerol clearance996NA228NA
Backes JM et al. [8]201246/M22 osteopenia secondary to hypercalciuriaNo2 ounces, 2–3 times weeklyHTG with little response to therapy; periodic TG levels reported as normal405 to 552 88NAclear
Backes JM et al. [8]201258/M26 hypertensionNoNoHTG with little response to therapy; periodic TG levels reported as normal381NANAclear
Arrobas-Velilla et al. [9]201321/Mnormalnonecardiovascular diseaseNoHTG with little response to fibrates497–638NA370clear
Backes JM et al. [10]201360/M27noneNA1–2 alcoholic drinks dailyHTG little response to therapy; healthy488 to 532 49NAclear
Backes JM et al. [10]201354/M21noneNANoHTG with little response to therapy; healthy368 to 538 114NAclear
Backes JM et al. [11]201552/MNAhypertension; a cerebral vascular accidentNo2 beers dailyHTG unresponsive to multiple treatments552 to 69562NAclear
Rajagopal R et al. [5]201756/FNAT2DM; hypertensionNo3 to 4 cocktails dailydrank glycerol sometimes1110NANANA
Farooq A et al. [4]2019NA/FNApancreatitis; T1DM; hypertension; ESRD; hypothyroidism; CHFNoNoHTG with little response to therapy; ingestion of soap; impaired renal function66201516469clear
Our case202546/M33.12pancreatitis;
T2DM
NoNoHTG unresponsive to multiple treatments; impaired renal function928.86103.25785.18clear
M, male; F, female; NA, information not available; ESRD, end-stage renal disease; CHF, congestive heart failure; T1DM, type 1 diabetes mellitus; T2DM, type 2 diabetes mellitus; HTG, hypertriglyceridemia; TG, triacylglycerol; G-C TG level, glycerol-corrected TG level; GKD, glycerol kinase deficiency; GK, glycerol kinase.
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.

Share and Cite

MDPI and ACS Style

Zhu, J.; Zhang, C.; Zhao, R. Pseudohypertriglyceridemia in a Patient with Pancreatitis Without Evidence for Glycerol Kinase Deficiency: A Rare Case Report and Review of the Literature. Diseases 2025, 13, 29. https://doi.org/10.3390/diseases13020029

AMA Style

Zhu J, Zhang C, Zhao R. Pseudohypertriglyceridemia in a Patient with Pancreatitis Without Evidence for Glycerol Kinase Deficiency: A Rare Case Report and Review of the Literature. Diseases. 2025; 13(2):29. https://doi.org/10.3390/diseases13020029

Chicago/Turabian Style

Zhu, Jianping, Chunjuan Zhang, and Rui Zhao. 2025. "Pseudohypertriglyceridemia in a Patient with Pancreatitis Without Evidence for Glycerol Kinase Deficiency: A Rare Case Report and Review of the Literature" Diseases 13, no. 2: 29. https://doi.org/10.3390/diseases13020029

APA Style

Zhu, J., Zhang, C., & Zhao, R. (2025). Pseudohypertriglyceridemia in a Patient with Pancreatitis Without Evidence for Glycerol Kinase Deficiency: A Rare Case Report and Review of the Literature. Diseases, 13(2), 29. https://doi.org/10.3390/diseases13020029

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop