Next Article in Journal
Acute Hypoxia Alters Extracellular Vesicle Signatures and the Brain Citrullinome of Naked Mole-Rats (Heterocephalus glaber)
Next Article in Special Issue
Antifungal Activity of the Frog Skin Peptide Temporin G and Its Effect on Candida albicans Virulence Factors
Previous Article in Journal
Impact of Fluid Dynamics on the Viability and Differentiation Capacity of 3D-Cultured Jaw Periosteal Cells
Previous Article in Special Issue
Diagnostic and Therapeutic Potential for HNP-1, HBD-1 and HBD-4 in Pregnant Women with COVID-19
 
 
Search for Articles:
Title / Keyword
Author / Affiliation / Email
Journal
Article Type
 
 
Advanced Search
 
Section
Special Issue
Volume
Issue
Number
Page
 
Journals
IJMS
Volume 23
Issue 9
10.3390/ijms23094685
ijms-logo
Submit to this Journal Review for this Journal Propose a Special Issue
► Article Menu

Article Menu

share Share announcement Help format_quote Cite question_answer Discuss in SciProfiles thumb_up
...
Endorse textsms
...
Comment
first_page
settings
Order Article Reprints
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Communication

Garvicins AG1 and AG2: Two Novel Class IId Bacteriocins of Lactococcus garvieae Lg-Granada

by
Antonio Maldonado-Barragán
1,*,
Estíbaliz Alegría-Carrasco
2,
María del Mar Blanco
2,
Ana Isabel Vela
2,3,
José Francisco Fernández-Garayzábal
2,3,
Juan Miguel Rodríguez
4 and
Alicia Gibello
2,†
1
Infection and Global Health Division, School of Medicine, University of St Andrews, St Andrews KY16 9TF, UK
2
Department of Animal Health, Veterinary School, Complutense University, Av. Puerta de Hierro, 28040 Madrid, Spain
3
VISAVET Health Surveillance Centre, Complutense University, Av. Puerta de Hierro, 28040 Madrid, Spain
4
Department of Nutrition and Food Science, Veterinary School, Complutense University, Av. Puerta de Hierro, 28040 Madrid, Spain
*
Author to whom correspondence should be addressed.
†
Deceased.
Int. J. Mol. Sci. 2022, 23(9), 4685; https://doi.org/10.3390/ijms23094685
Submission received: 28 March 2022 / Revised: 21 April 2022 / Accepted: 21 April 2022 / Published: 23 April 2022
(This article belongs to the Special Issue Antimicrobial Peptides: Structure and Mechanism of Biological Activity)
Browse Figures
Review Reports Versions Notes

Abstract

:
Lactococcus garvieae causes infectious diseases in animals and is considered an emerging zoonotic pathogen involved in human clinical conditions. In silico analysis of plasmid pLG50 of L. garvieae Lg-Granada, an isolate from a patient with endocarditis, revealed the presence of two gene clusters (orf46–47 and orf48–49), each one encoding a novel putative bacteriocin, i.e., garvicin AG1 (GarAG1; orf46) and garvicin AG2 (GarAG2; orf48), and their corresponding immunity proteins (orf47 and orf49). The chemically synthesised bacteriocins GarAG1 and GarAG2 presented inhibitory activity against pathogenic L. garvieae strains, with AG2 also being active against Listeria monocytogenes, Listeria ivanovii and Enterococcus faecalis. Genetic organisation, amino acid sequences and antimicrobial activities of GarAG1 and GarAG2 indicate that they belong to linear non-pediocin-like one-peptide class IId bacteriocins. Gram-positive bacteria that were sensitive to GarAG2 were also able to ferment mannose, suggesting that this bacteriocin could use the mannose phosphotransferase transport system (Man-PTS) involved in mannose uptake as a receptor in sensitive strains. Intriguingly, GarAG1 and GarAG2 were highly active against their own host, L. garvieae Lg-Granada, which could be envisaged as a new strategy to combat pathogens via their own weapons.

1. Introduction

Lactococcus garvieae is a bacterial species that can be isolated from a wide spectrum of environmental, animal and food sources, including natural aquatic environments, sewage water, birds, fish, vegetables, meats, meat products and artisan dairy products [1,2,3,4]. In addition, this species is responsible for fish lactococcosis, a relevant infectious disease affecting different wild and farmed fish species [5,6], and has also been associated with some infectious conditions in domestic mammals [7,8,9]. In fact, L. garvieae is considered a potential zoonotic pathogen [10], as it is increasingly involved in a variety of human clinical conditions, from urinary tract infections and pneumonia to peritonitis, spondylodiscitis, acute cholecystitis, septicemia or endocarditis [11,12,13,14,15,16,17]. In recent years, the availability of more accurate methods for bacterial identification from clinical specimens, such as matrix-assisted laser desorption/ionization time-of-flight (MALDI-TOF) mass spectrometry (MS) and PCR amplification and sequencing of the 16S ribosomal DNA gene, has enabled the recognition of L. garvieae as an emerging agent of infective endocarditis involving both native and prosthetic valves [18,19,20,21,22,23,24].
Many bacterial strains are able to produce ribosomally synthesized antimicrobial peptides, so-called bacteriocins. The production of these antimicrobial peptides may contribute to bacterial fitness and may confer competitive advantages for survival and environmental spread [25,26]. In addition, bacteriocins have been proposed as an alternative to antibiotics due to concerns raised about antibiotic (multi)resistance among clinically relevant bacteria [25,27]. Seven garvicins (bacteriocins produced by L. garvieae strains) have been reported to date: garvicin L1-5 [28], garvicin ML [29], garvicin Q [30], garvicin A [31], garvicin KS [32], and garvicins B and C [33]. It was recently described that to exert their antimicrobial activity, garvicins A, B, C and Q (GarA, GarB, GarC and GarQ) can target a mannose-specific phosphotransferase system (Man-PTS) present on the membrane of sensitive strains [33,34].
L. garvieae Lg-Granada was originally isolated from the blood of a patient with endocarditis [20]. Although this strain does not exhibit bacteriocinogenic activity, sequencing of its plasmid pLG50 revealed the presence of two sets of genes (orf46–47 and orf48–49), each one encoding a novel putative bacteriocin (orf46 and orf48), and their respective immunity proteins (orf47 and orf49) [35]. Because of the potential of garvicins as future antimicrobial agents in clinical and food settings, the objectives of this work were, first, to elucidate whether the bacteriocin-like peptides encoded by orf46 and orf48 actually displayed antimicrobial activity and, if so, to determine their respective antimicrobial spectra; and second, to assess the fermentation capacity of mannose of the sensitive indicator strains in order to determine whether the mannose phosphotransferase (Man-PTS) transporter system may be a possible cellular target for the recognition of these bacteriocins.

2. Results

2.1. Analysis of Bacteriocin-Related Genes in the Sequence of Plasmid pLG50 of L. garvieae Lg-Granada

Both garvicin AG1 (GarAG1) and garvicin AG2 (GarAG2) belong to class IId (non-pediocin single linear peptides) bacteriocins [36]. GarAG1 is predicted to be synthesized as a 61-amino-acid precursor peptide that contains a 20-amino-acid double-glycine (GG) leader peptide, which, one processed, would render a mature bacteriocin peptide of 41 amino acids (Figure 1A). Although it shared high similarity with hypothetical proteins or putative bacteriocins of Lactococcus petauri and Lactococcus garvieae (Figure S1A), the similarity with other known bacteriocins, such as garvicin Q (GarQ) and garvicin A (GarA) was low and mainly confined to the leader peptide. Thus, although the leader peptides of GarAG1, GarQ and GarA were 95% identical, no significant similarities were found between the mature peptides (Figure 1A).
GarAG2 is presumably synthesized as a 70-amino-acid precursor peptide with a double-glycine leader peptide of the GS type, where the second glycine is substituted by a serine residue; once processed, it would produce a mature bacteriocin peptide of 50 amino acids (Figure 1B). GarAG2 precursor peptide showed similarity with hypothetical proteins, putative pheromones/bacteriocins and known bacteriocins belonging to several species of the families Enterococcaceae, Lactobacillaceae, Streptococcaceae and Leuconostocaceae (Figure S1B). Its closest known homologs (as precursor peptide bacteriocins) were garvicin Q, BacSJ, bovicin 255 and acidocin M, 84%, 46%, 42% and 46% shared identity, respectively. The GarAG2 leader peptide was similar to that of garvicin Q (75% shared identity) but showed low shared identity (<40%) with the leader peptides of BacSJ, acidocin M and bovicin 255 (Figure 1B). The amino acid sequence of mature GarAG2 showed 94%, 51%, 51% and 49% shared identity with the predicted mature peptides of garvicin Q, BacSJ, acidocin M and bovicin 255, respectively, sharing the N-terminal NGY and the central VTK conserved motifs (Figure 1B).
GarAG1 and GarAG2 shared 70% identity in their leader peptides, but their predicted mature peptides were quite different (<15% shared identity). Their alignment with known class IId bacteriocins that use the Man-PTS system as a receptor showed no appreciable conserved motifs (Figure 1C). Neither GarAG1 nor GarAG2 contained the pediocin-like motif YGNGVXC in their amino acid sequence.
Analysis of plasmid pLG50 revealed that the structural genes of precursor peptides GarAG1 (orf46, locus tag LA387_RS11080) and GarAG2 (orf48, locus tag LA387_RS11090) are located in close vicinity within the same locus (Figure 2). Just downstream of orf46, there is a gene (orf47, locus tag LA387_RS11085) that encodes a putative 99-aas protein (pI 9.70) showing 99% shared identity with hypothetical proteins of Lactococcus petauri. A putative promoter sequence (P1) containing the conserved −10 and −35 regions was found upstream of orf46. Downstream of orf48, there is a gene (orf49, locus tag LA387_RS11095) that encodes a putative 104-aas protein (pI 9.36) identical to the putative immunity protein of garvicin Q (AEN79391.1). A putative promoter sequence (P2) was found upstream of orf48, just overlapping the final coding sequence of orf47, whereas two inverted repeats of 8 bp (separated by 9 bp), which may function as a Rho-independent transcription terminator, were found just downstream of orf49. This genetic organization suggests that two putative transcripts could be generated: one driven by P1, which would include orf46, orf47, orf48 and orf49; and one driven by P2, which would include orf48 and orf49 (Figure 2).
Upstream of orf46, there is a gene encoding a putative 185-aas protein that was identical to a recombinase family protein with a helix–turn–helix (HTH) domain of Lactococcus garvieae (WP_107106295). This protein is a serine recombinase similar to Escherichia coli transposon gamma–delta resolvase that catalyses the site-specific recombination of the transposon and also regulates its frequency of transposition (domain architecture ID 10133007). Downstream of orf49, there is a gene encoding a putative 228-aas protein that is virtually identical to IS6-like element IS1216 family transposase (protein family model: NBR001266) found in Enterococcus, Lactococcus and Streptococcus, among others (Figure 2).

2.2. Antimicrobial Activity of L. garvieae Lg-Granada

The cell-free supernatants (CFS) of L. garvieae Lg-Granada did not show antimicrobial activity against L. garvieae 8831, whereas those obtained from L. garvieae 21881, a garvicin-A-producing strain, led to inhibition halos >10 mm. Because no genes involved in precursor peptide processing and transport were found in plasmid pLG50, a fact that might impede its maturation and extracellular secretion, cell lysates of L. garvieae Lg-Granada were also tested. However, cell lysates showed no antimicrobial activity against the indicator strain, L. garvieae 8831. Therefore, it was decided to synthesize the peptides corresponding to the mature bacteriocins devoid of their potential leader sequences in order to determine whether they actually possess antimicrobial activity.

2.3. Antimicrobial Activity of the Chemically Synthesized Garvicins AG1 and AG2

Both peptides, GarAG1 and GarAG2, showed antimicrobial activity against some of the Gram-positive indicator strains tested in this work (Table 1). However, the antimicrobial spectrum of the two garvicins was very different. The spectrum of GarAG1 was narrow and active against L. garvieae (16 strains inhibited of 18 tested; 16/18) and Pediococcus acidilactici (1/1), whereas GarAG2 showed a wider spectrum of activity and included strains belonging to different genera and species, such as Carnobacterium maltaromaticum (1/1), Enterococcus faecalis (3/3), L. garvieae (16/18), Lactococcus lactis (2/2), Listeria ivanovii (1/1), Listeria monocytogenes (1/1) and Streptococcus salivarius (1/1).
In addition, GarAG2 was more active than GarAG1 for those indicator strains that were susceptible to both garvicins, with the only exception of P. acidilactici CECT 98, which was sensitive only to GarAG1. Hence, the inhibition zones displayed by GarAG2 and GarAG1 against the susceptible L. garvieae strains ranged from 12 to 22 mm and 9 to 16 mm diameter, respectively. None of the garvicins showed activity against the two Gram-negative strains (E. coli CECT 515T and Salmonella enterica S79) included in the assays.
It must be highlighted that despite the fact that the plasmid pLG50 of L. garvieae Lg-Granada contains immunity genes for GarAG1 (orf47) and GarAG2 (orf49), this strain was sensitive to both garvicins. In contrast, the garvicin-A-producing L. garvieae 21881 strain and its derivative, L. garvieae 21881-N, which lacks all the genes required for garvicin A production and immunity, were resistant to both GarAG1 and GarAG2.
Garvicins AG1 and AG2 did not display additive or synergistic antimicrobial activities, as the size (18 mm) of the inhibition halo of the disk containing both GarAG1 (2.5 μg) and GarAG2 (2.5 μg) was identical to that displayed by GarAG2 alone (2.5 μg) against L. garvieae 8831. In addition, the sizes of the inhibition zones when two disks containing the same concentrations (2.5 μg) of GarAG1 (14 mm) and GarAG2 (18 mm) were placed immediately adjacent on each other were identical to those displayed by the respective garvicins when each disk was placed in a different location within the same plate. The minimal inhibitory concentration (MIC) value of GarAG1 was 5 μg/mL against L. garvieae 8831, whereas those of GarAG2 were 2.5, 0.1 and 0.1 μg/mL against L. garvieae 8831, E. faecalis OEA1 and L. monocytogenes 51112, respectively. These data are in agreement with the inhibition halos displayed by GarAG1 and GarAG2 against such indicator strains.

2.4. Relationship between Sensitivity to Garvicins AG1 and AG2 and Mannose Fermentation Ability

No significant relationship was found between the sensitivity of the indicator strains to GarG1 and their ability to ferment mannose (Table 1). Conversely, all the Gram-positive indicator strains that were sensitive to GarAG2 (25 out of 34 strains) were able to ferment mannose. In addition, most of the Gram-positive indicator strains that fermented mannose (28 out of 34 strains) were sensitive to GarAG2 (Table 1). The only exceptions were S. aureus CECT 86T, L. garvieae 21881 (garvicin A producer) and its derivative, L. garvieae 21881-N (garvicin A non-producer), which showed a mannose fermentation ability but were resistant to GarAG2. In contrast, the rest of the Gram-positive strains that were resistant to GarAG2 (Aerococcus viridans CECT 978T, Bacillus cereus CECT 5050T, P. acidilactici CECT 98, Streptococcus agalactiae MP007, Streptococcus parauberis CCUG 39954T and Streptococcus uberis CECT 994T) did not ferment mannose (Table 1).

3. Discussion

In this work, in silico analysis of the gene sequence of plasmid pLG50 of L. garvieae Lg-Granada allowed for the identification of the structural and immunity genes of two novel bacteriocins: garvicins AG1 and AG2. Based on the genetic organisation of the genes encoding GarAG1 and GarAG2, their corresponding deduced amino acid sequences, which lack the conserved pediocin-like motif YGNGVXC, and their non-synergistic antimicrobial activity, both garvicins are considered to belong to the class IId one-peptide bacteriocins [36]. Although two promoters (P1 and P2) were identified and, in theory, two putative transcripts could be generated, one driven by P1, (orf46-orf47-orf48-orf49) and the other by P2 (orf48-orf49) (Figure 2), bacteriocinogenic activity was not detected either in the CFS or in the cell lysates obtained from L. garvieae Lg-Granada. The fact that L. garvieae Lg-Granada was very sensitive to both bacteriocins could indicate a lack of expression of these genes (including the immunity genes). Lactic acid bacteria frequently contain silent (cryptic) bacteriocins that cannot be produced by the host cell because of a lack of key genes required for their biosynthesis, regulation, processing or transport or even because of the absence of the appropriate social environment [26,37].
In relation to garvicins, it has been previously found that L. garvieae 21881 not only produces garvicin A [31] but also contains the structural genes of two unexpressed bacteriocins, garvicin B (GarB) and garvicin C (GarC) (accession no. WP_014386584.1 and WP_014386275.1, respectively), which are encoded in its plasmids, pGL2 and pGL1, respectively [33]. The authors hypothesized that they are not expressed because of a lack of genes required for their secretion. However (and similarly to GarAG1 and AG2), the biochemically synthesized GarB and GarC bacteriocins showed antimicrobial activity.
The existence in plasmid pLG50 of a transposase-encoding insertion sequence (IS1216) downstream of orf48-orf49, together with the transposon resolvase located upstream of orf46-orf47, resembles the structure of the Tn1546 transposon that carries vancomycin-resistant genes [38]. This could indicate that the garvicin AG1 and AG2 gene clusters could have been recently acquired by L. garvieae Lg-Granada through horizontal transfer of plasmid pLG50 or through independent transposition events related to IS1216, lacking the genes needed for its production, processing or secretion. In this regard, the absence of a dedicated ATP-binding cassette (ABC) transporter could prevent the processing of the double-glycine (GG) leader peptide and the secretion of the mature (active) garvicins, thus explaining the lack of antimicrobial activity displayed by L. garvieae Lg-Granada. The lack of a dedicated ABC transporter could also explain the sensitivity of L. garvieae Lg-Granada to GarAG1 and GarAG2, as these transporters can be involved in providing immunity to bacteriocins [39].
Similarly to GarA, GarB and Gar C [31,33], GarAG1 has a narrow antimicrobial spectrum, mostly limited to L. garvieae strains. In contrast, the antimicrobial spectrum of GarAG2 is wider, and in addition to species of the genus Lactococcus, it targets strains of the genera Enterococcus, Streptococcus and Listeria. The spectrum of GarAG2 seems very similar to that of GarQ, including the lack of sensitivity of Pediococcus strains [30,34], which could be explained by the high amino acid identity (94%) between the two garvicins.
The Man-PTS transport system [40] is used by subclass IIa bacteriocins (pediocin PA-1-like bacteriocins) and subclass IId bacteriocins, including GarA, GarB, GarC and GarQ [33,34], as a receptor in sensitive bacterial cells. Among other functions, this system is responsible for mannose uptake and phosphorylation. Interestingly, all the Gram-positive indicator strains that were sensitive to GarAG2 were also able to ferment mannose, whereas those that did not ferment this sugar were resistant to the bacteriocin. These results, together with the high amino acid sequence similarity between GarAG2 and GarQ, suggest that GarAG2 most probably also uses the Man-PTS system as its main target in bacterial cells. This is an interesting property as a tool for bacterial control because eukaryotic cells lack such a system [41]. On the contrary, we did not find a relationship between GarAG1 activity and the ability of the sensitive strains to ferment mannose, indicating that GarAG1 does not target the Man-PTS system to exert its antimicrobial activity.
Among the Gram-positive indicator strains, S. aureus CECT 86T, L. garvieae 21881 and L. garvieae 21881-N (mannose-positive but resistant to GarAG2) were the only exceptions to this association between mannose fermentation and sensitivity to GarAG2. Cross-immunity between GarA and GarAG2 might be an explanation for this phenotype, as L. garvieae 21881 produces GarA and expresses its corresponding immunity gene. However, this is not a valid explanation because L. garvieae 21881-N is a derivative of L. garvieae 21881 that lacks the pGL5 plasmid containing the genes involved in garvicin A biosynthesis, immunity, processing and transport [31]. A plausible explanation could be the fact that both L. garvieae 21881 and its derivative, L. garvieae 21881-N, harbour the plasmids pGL1 and pGL2, which encode garvicins GarC and GarB (and their corresponding immunity genes), respectively, thus providing cross-immunity to both GarAG1 and AG2. Although the mechanism of resistance to GarAG2 of L. garvieae 21881 is currently unknown, resistance to the action of a class IIa or class IId bacteriocin linked to the preservation of the ability to ferment mannose has already been described [34].
The two Gram-negative strains tested in this study were able to ferment mannose but were resistant to GarAG2. It must be highlighted that no lactococcal bacteriocin has antimicrobial activity against intact Gram-negative bacteria, as the outer membranes of these bacteria prevents the interaction between the bacteriocin and its receptors, which are located in the plasmatic membrane [42].
Both GarAG1 and GarAG2 have remarkable activity against L. garvieae strains, which renders these bacteriocins attractive tools to control this species in aquaculture systems. In addition, the spectrum of GarAG2 includes L. monocytogenes, a very relevant foodborne pathogen and, as a consequence, one of the main targets in bacteriocin research [43]. However, we are aware of the many limitations that these bacteriocins face for practical applications. Because L. garvieae Lg-Granada harbours the structural gene for GarAG1 and GarAG2 but does not express them, their heterologous expression at high levels in safe strains is one approach for the application of these bacteriocins in clinical settings or food systems [44]. However, the lack of genes encoding their processing and secretion would make necessary the use of the secretory machinery of other class IId bacteriocins, such as that of GarA or GarQ [33]. In this context, the use of a natural GarA producer strain (in the case of GarAG1) or a natural GarQ producer strain (in the case of GarAG2) may be a more practical approach, given the similarities between their respective antimicrobial spectra. Finally, another way to use the potential of these bacteriocins is through the use of synthetic peptides in a pharma-like setting, although this would require a considerable investment and regulatory changes. In conclusion, this study confirms that mining the increasing number of bacterial genomes is an excellent strategy for the discovery of active but not expressed novel bacteriocins and may introduce several surprises in the future. To our knowledge, this is the first study reporting the discovery of bacteriocins that are active against the pathogenic bacteria that harbour them, which can be envisaged as a strategy to combat pathogens with their own weapons.

4. Materials and Methods

4.1. Bacterial Strains and Growth Conditions

Bacteria used in this study included pathogenic isolates of veterinary and clinical relevance isolated from food, animals and humans, as well as other non-pathogenic isolates involved in food fermentations (Table 1). Lactococcus garvieae Lg-Granada was originally isolated from a patient with endocarditis in the mitral valve [20]. Enterococcus, Listeria, Streptococcus and Staphylococcus strains were routinely grown in brain heart infusion (BHI; Oxoid, Basingstoke, UK); Carnobacterium, Lactococcus and Pediococcus strains were grown in de Man, Rogosa and Sharpe (MRS) medium (Oxoid, Basingstoke, UK); and Escherichia, and Salmonella strains were grown in Luria-Bertani (LB) medium (Table 1). The samples were maintained as frozen stocks at −80 °C in MRS or BHI plus 20% (vol/vol) glycerol. All strains were incubated for 24 h at 30 °C without agitation, except for Gram-negative strains, which were grown at 37 °C with agitation.

4.2. DNA and Amino Acid Sequence Analysis

Searches for potential DNA and amino acid similarities of plasmid pLG50 of L. garvieae Lg-Granada (GenBank acc. no. CP084378.1; RefSeq acc. no. NZ_CP084378.1) in nucleotide and protein databases were carried out using the Basic Local Alignment Search Tool (BLAST; http://blastncbi.nlm.nih.gov/; access date: 1 December 2021) [45]. Promoter sequences were predicted with Softberry BProm (Softberry, Inc., Mount Kisco, NY, USA; www.softberry.com; access date: 1 December 2021) [46]. Rho-independent terminators were detected with the ARNold Web server (http://rssf.i2bc.paris-saclay.fr/toolbox/arnold/; access date: 1 December 2021) [47]. The MultAlin multiple sequence alignment interface page (http://multalin.toulouse.inra.fr/multalin/; access date: 1 December 2021) was used for alignment of the amino acid sequences [48]. Finally, the WinPep program (Lars Hennig, Freiburg, Germany) [49] was used for physicochemical analysis of peptides (isoelectric point, molecular weight).

4.3. Preparation of Garvicins AG1 and AG2

The putative mature bacteriocins encoded by orf46 (GRETLAQDIKRVYDSIWPNDTAWYTGKNNKTNIPPYSPYGH) and orf48 (GTPLFYGANGYLTRENGKYVYRVTKDPVSAVFGVISNGWGSAGAGFGPQH), termed garvicin AG1 (GarAG1) and AG2 (GarAG2), respectively, after Prof. Alicia Gibello, were chemically synthesized by GenScript Biotech (Piscataway, NJ, USA), with >95% purity. None of the synthesized peptides was formylated. The peptides were solubilized to concentrations of 1 and 0.1 mg/mL in 0.1% (vol/vol) trifluoroacetic acid (Sigma-Aldrich, Madrid, Spain) and stored at −20 °C until use.

4.4. Bacteriocin Assays

Initially, the antimicrobial activity of the cell-free supernatants (CFS) and cell lysates of L. garvieae Lg-Granada was assessed by an agar diffusion test [31] using L. garvieae 8831 as the indicator strain and L. garvieae 21881 (a garvicin-A-producing strain) and its derivative, L. garvieae 21881-N (garvicin A non-producer), as positive and negative control, respectively.
CFS were prepared by centrifuging 2 mL of 16 h overnight cultures of L. garvieae Lg-Granada at 10,000× g for 3 min. Then, the supernatants were filtered through cellulose acetate membrane filters with a 0.22 μm pore size (Sartorius, Göttingen, Germany). To prepare the cell lysates, the cell pellets from the overnight cultures were resuspended in 100 μL of sterile MRS and separated into two fractions. Sterile glass beads were added to the first fraction, and a lysis matrix (MP Biomedicals, Solon, OH, USA) was added to the second fraction. Subsequently, both fractions were lysed by 3 cycles of FastPrep (MP Biomedicals, Solon, OH, USA) at a speed of 4 m/s for 20 s. Wells (diameter, 4.0 mm) were created with a sterile cork borer on the agar plates where the indicator strains had been inoculated. Each well was filled with either 100 μL of a CFS or 100 μL of a cell lysate. Plates were incubated at 30 °C for 16 h, and then the diameters of the inhibition zones were recorded.
The antimicrobial activity of garvicins AG1 and AG2 was assayed by an agar diffusion test in which wells were replaced by sterile disks impregnated with 2.5 μg of the tested peptide. All the species and strains used as indicator microorganisms to determine the spectrum of activity of the bacteriocins are listed in Table 1. L. garvieae 8831 was used as the indicator strain to assess whether either of the garvicins might have synergistic or additive activity. In this case, disks containing each bacteriocin (GarAG1 or GarAG2) were placed adjacent to each other on the same plate, and disks containing both bacteriocins (GarAG1 plus GarAG2) were also included in the assays; their inhibition halos were compared with those observed for non-adjacent disks containing each garvicin.
To determine the minimal inhibitory concentration (MIC) of garvicins AG1 and AG2, three sensitive indicator strains (L. garvieae 8831, Listeria monocytogenes 51112 and Enterococcus faecalis OEA1) were used (Table 1). For this purpose, the indicator stains were grown in Mueller–Hinton broth (MH; Fisher Scientific, Pittsburgh, PA, USA) and inoculated in 96-well microtiter plates at a concentration of 1.5 × 106 colony forming units per millilitre (CFU/mL). Each bacteriocin was tested at the following final concentrations: 5, 4, 3, 2.5, 2, 1.5, 1, 0.5, 0.25, 0.1 and 0 μg/mL.

4.5. Mannose Fermentation Ability among the Indicator Strains

The amino acid sequence of mature GarAG2 showed a very high degree of identity with garvicin Q (see below), a bacteriocin that uses the Man-PTS system to recognize target cells [34]. As a consequence and in order to elucidate whether the Man-PTS system may be a possible cellular target for the recognition of garvicin AG2, mannose fermentation ability of the indicator strains was tested in mannose-phenol red broth (tryptone, 10 g/L; mannose, 10 g/L; sodium chloride, 5 g/L; phenol red, 0.018 g/L). Phenol red acts as a pH indicator, staying red in the 6.8–8 range and turning yellow at acidic pH, indicating fermentation. The tubes were incubated at 37 °C for 24 h, and a non-inoculated tube was included as a negative fermentation control.

Supplementary Materials

The following supporting information can be downloaded at: https://www.mdpi.com/article/10.3390/ijms23094685/s1.

Author Contributions

Conceptualization, A.I.V., J.M.R. and A.G.; methodology, A.M.-B., E.A.-C. and A.G.; software, A.M.-B.; validation, A.I.V., J.F.F.-G. and J.M.R.; formal analysis, A.M.-B. and E.A.-C.; investigation, A.M.-B., E.A.-C. and M.d.M.B.; resources, A.I.V. and A.G.; data curation, A.M.-B.; writing—original draft preparation, A.M.-B. and J.M.R.; writing—review and editing, E.A.-C., M.d.M.B., A.I.V. and J.F.F.-G.; visualization, A.M.-B.; supervision, M.d.M.B., A.I.V., J.F.F.-G., J.M.R. and A.G.; project administration, A.I.V. and A.G.; funding acquisition, A.I.V. and A.G. All authors have read and agreed to the published version of the manuscript.

Funding

This research was funded by the Spanish Ministry of Science, Innovation, and Universities, grant number RTI2018-098530-B-I00. The APC was funded by the Spanish Ministry of Science, Innovation, and Universities, grant number RTI2018-098530-B-I00.

Institutional Review Board Statement

Not applicable.

Informed Consent Statement

Not applicable.

Data Availability Statement

The genome sequence of plasmid pLG50 of Lactococcus garvieae Lg-Granada (35) is deposited in GenBank under the accession numbers CP084378.1 and NZ_CP084378.1.

Acknowledgments

The authors would like to dedicate this work to the memory of Alicia Gibello Prieto, who started and worked through the initial stages of this project; she was a permanent source of inspiration and support. We thank Frank Steven Padilla Ochoa for his collaboration.

Conflicts of Interest

The authors declare no conflict of interest. The funders had no role in the design of the study; in the collection, analyses, or interpretation of data; in the writing of the manuscript, or in the decision to publish the results.

References

  1. Santos, E.M.; Jaime, I.; Rovira, J.; Lyhs, U.; Korkeala, H.; Björkroth, J. Characterization and identification of lactic acid bacteria in “morcilla de Burgos”. Int. J. Food Microbiol. 2005, 97, 285–296. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  2. Kawanishi, M.; Yoshida, T.; Kijima, M.; Yagyu, K.; Nakai, T.; Okada, S.; Endo, A.; Murakami, M.; Suzuki, S.; Morita, H. Characterization of Lactococcus garvieae isolated from radish and broccoli sprouts that exhibited a KG+ phenotype, lack of virulence and absence of a capsule. Lett. Appl. Microbiol. 2007, 44, 481–487. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  3. Alegría, A.; Alvarez-Martín, P.; Sacristán, N.; Fernández, E.; Delgado, S.; Mayo, B. Diversity and evolution of the microbial populations during manufacture and ripening of Casín, a traditional Spanish, starter-free cheese made from cow’s milk. Int. J. Food Microbiol. 2009, 136, 44–51. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  4. Reguera-Brito, M.; Galán-Sánchez, F.; Blanco, M.M.; Rodríguez-Iglesias, M.; Domínguez, L.; Fernández-Garayzábal, J.F.; Gibello, A. Genetic analysis of human clinical isolates of Lactococcus garvieae: Relatedness with isolates from foods. Infect. Genet. Evol. 2016, 37, 185–191. [Google Scholar] [CrossRef] [PubMed]
  5. Vendrell, D.; Balcázar, J.L.; Ruiz-Zarzuela, I.; de Blas, I.; Gironés, O.; Múzquiz, J.L. Lactococcus garvieae in fish: A review. Comp. Immunol. Microbiol. Infect. Dis. 2006, 29, 177–198. [Google Scholar] [CrossRef] [PubMed]
  6. Meyburgh, C.M.; Bragg, R.R.; Boucher, C.E. Lactococcus garvieae: An emerging bacterial pathogen of fish. Dis. Aquat. Organ. 2017, 123, 67–79. [Google Scholar] [CrossRef]
  7. Teixeira, L.M.; Merquior, V.L.; Vianni, M.C.; Carvalho, M.G.; Fracalanzza, S.E.; Steigerwalt, A.G.; Brenner, D.J.; Facklam, R.R. Phenotypic and genotypic characterization of atypical Lactococcus garvieae strains isolated from water buffalos with subclinical mastitis and confirmation of L. garvieae as a senior subjective synonym of Enterococcus seriolicida. Int. J. Syst. Bacteriol. 1996, 46, 664–668. [Google Scholar] [CrossRef] [Green Version]
  8. Vela, A.I.; Vázquez, J.; Gibello, A.; Blanco, M.M.; Moreno, M.A.; Liébana, P.; Albendea, C.; Alcalá, B.; Mendez, A.; Domínguez, L.; et al. Phenotypic and genetic characterization of Lactococcus garvieae isolated in Spain from lactococcosis outbreaks and comparison with isolates of other countries and sources. J. Clin. Microbiol. 2000, 38, 3791–3795. [Google Scholar] [CrossRef] [Green Version]
  9. Tejedor, J.L.; Vela, A.I.; Gibello, A.; Casamayor, A.; Domínguez, L.; Fernández-Garayzábal, J.F. A genetic comparison of pig, cow and trout isolates of Lactococcus garvieae by PFGE analysis. Lett. Appl. Microbiol. 2011, 53, 614–619. [Google Scholar] [CrossRef]
  10. Gibello, A.; Galán-Sánchez, F.; Blanco, M.M.; Rodríguez-Iglesias, M.; Domínguez, L.; Fernández-Garayzábal, J.F. The zoonotic potential of Lactococcus garvieae: An overview on microbiology, epidemiology, virulence factors and relationship with its presence in foods. Res. Vet. Sci. 2016, 109, 59–70. [Google Scholar] [CrossRef]
  11. Fefer, J.J.; Ratzan, K.R.; Sharp, S.E.; Saiz, E. Lactococcus garvieae endocarditis: Report of a case and review of the literature. Diagn. Microbiol. Infect. Dis. 1998, 32, 127–130. [Google Scholar] [CrossRef]
  12. Wang, C.Y.; Shie, H.S.; Chen, S.C.; Huang, J.P.; Hsieh, I.C.; Wen, M.S.; Lin, F.C.; Wu, D. Lactococcus garvieae infections in humans: Possible association with aquaculture outbreaks. Int. J. Clin. Pract. 2007, 61, 68–73. [Google Scholar] [CrossRef] [PubMed]
  13. Li, W.K.; Chen, Y.S.; Wann, S.R.; Liu, Y.C.; Tsai, H.C. Lactococcus garvieae endocarditis with initial presentation of acute cerebral infarction in a healthy immunocompetent man. Intern. Med. 2008, 47, 1143–1146. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  14. Aguado-Urda, M.; López-Campos, G.H.; Blanco, M.M.; Fernández-Garayzábal, J.F.; Cutuli, M.T.; Aspiroz, C.; López-Alonso, V.; Gibello, A. Genome sequence of Lactococcus garvieae 21881, isolated in a case of human septicemia. J. Bacteriol. 2011, 193, 4033–4034. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  15. Chan, J.F.; Woo, P.C.; Teng, J.L.; Lau, S.K.; Leung, S.S.; Tam, F.C.; Yuen, K.Y. Primary infective spondylodiscitis caused by Lactococcus garvieae and a review of human L. garvieae infections. Infection 2011, 39, 259–264. [Google Scholar] [CrossRef] [Green Version]
  16. Kim, J.H.; Go, J.; Cho, C.R.; Kim, J.I.; Lee, M.S.; Park, S.C. First report of human acute acalculous cholecystitis caused by the fish pathogen Lactococcus garvieae. J. Clin. Microbiol. 2013, 51, 712–714. [Google Scholar] [CrossRef] [Green Version]
  17. Choksi, T.T.; Dadani, F. Reviewing the Emergence of Lactococcus garvieae: A Case of Catheter Associated Urinary Tract Infection Caused by Lactococcus garvieae and Escherichia coli Coinfection. Case Rep. Infect. Dis. 2017, 2017, 5921865. [Google Scholar] [CrossRef] [Green Version]
  18. Wilbring, M.; Alexiou, K.; Reichenspurner, H.; Matschke, K.; Tugtekin, S.M. Lactococcus garvieae causing zoonotic prosthetic valve endocarditis. Clin. Res. Cardiol. 2011, 100, 545–546. [Google Scholar] [CrossRef]
  19. Fleming, H.; Fowler, S.V.; Nguyen, L.; Hofinger, D.M. Lactococcus garvieae multi-valve infective endocarditis in a traveler returning from South Korea. Travel Med. Infect. Dis. 2012, 10, 101–104. [Google Scholar] [CrossRef]
  20. Heras Cañas, V.; Pérez Ramirez, M.D.; Bermudez Jiménez, F.; Rojo Martin, M.D.; Miranda Casas, C.; Marin Arriaza, M.; Navarro Marí, J.M. Lactococcus garvieae endocarditis in a native valve identified by MALDI-TOF MS and PCR-based 16s rRNA in Spain: A case report. New Microbes New Infect. 2015, 5, 13–15. [Google Scholar] [CrossRef] [Green Version]
  21. Tsur, A.; Slutzki, T.; Flusser, D. Lactococcus garvieae Endocarditis on a Prosthetic Biological Aortic Valve. Zoonoses Public Health 2015, 62, 435–437. [Google Scholar] [CrossRef] [PubMed]
  22. Suh, Y.; Ja Kim, M.; Seung Jung, J.; Pil Chong, Y.; Hwan Kim, C.; Kang, Y.; Wook Sohn, J.; Kyung Yoon, Y. Afebrile Multi-valve Infective Endocarditis Caused by Lactococcus garvieae: A Case Report and Literature Review. Intern. Med. 2016, 55, 1011–1015. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  23. Rösch, R.M.; Buschmann, K.; Brendel, L.; Schwanz, T.; Vahl, C.F. Lactococcus garvieae Endocarditis in a Prosthetic Aortic Valve: A Case Report and Literature Review. J. Investig. Med. High Impact Case Rep. 2019, 7, 2324709619832052. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  24. Malek, A.; De la Hoz, A.; Gomez-Villegas, S.I.; Nowbakht, C.; Arias, C.A. Lactococcus garvieae, an unusual pathogen in infective endocarditis: Case report and review of the literature. BMC Infect. Dis. 2019, 19, 301. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  25. Cotter, P.D.; Ross, R.P.; Hill, C. Bacteriocins—A viable alternative to antibiotics? Nat. Rev. Microbiol. 2013, 11, 95–105. [Google Scholar] [CrossRef] [PubMed]
  26. Maldonado-Barragán, A.; West, S.A. The cost and benefit of quorum sensing-controlled bacteriocin production in Lactobacillus plantarum. J. Evol. Biol. 2020, 33, 101–111. [Google Scholar] [CrossRef] [PubMed]
  27. García-Bayona, L.; Comstock, L.E. Bacterial antagonism in host-associated microbial communities. Science 2018, 361, eaat2456. [Google Scholar] [CrossRef] [Green Version]
  28. Villani, F.; Aponte, M.; Blaiotta, G.; Mauriello, G.; Pepe, O.; Moschetti, G. Detection and characterization of a bacteriocin, garviecin L1-5, produced by Lactococcus garvieae isolated from raw cow’s milk. J. Appl. Microbiol. 2001, 90, 430–439. [Google Scholar] [CrossRef]
  29. Borrero, J.; Brede, D.A.; Skaugen, M.; Diep, D.B.; Herranz, C.; Nes, I.F.; Cintas, L.M.; Hernández, P.E. Characterization of garvicin ML, a novel circular bacteriocin produced by Lactococcus garvieae DCC43, isolated from mallard ducks (Anas platyrhynchos). Appl. Environ. Microbiol. 2011, 77, 369–373. [Google Scholar] [CrossRef] [Green Version]
  30. Tosukhowong, A.; Zendo, T.; Visessanguan, W.; Roytrakul, S.; Pumpuang, L.; Jaresitthikunchai, J.; Sonomoto, K. Garvieacin Q, a novel class II bacteriocin from Lactococcus garvieae BCC 43578. Appl. Environ. Microbiol. 2012, 78, 1619–1623. [Google Scholar] [CrossRef] [Green Version]
  31. Maldonado-Barragán, A.; Cárdenas, N.; Martínez, B.; Ruiz-Barba, J.L.; Fernández-Garayzábal, J.F.; Rodríguez, J.M.; Gibello, A. Garvicin A, a novel class IId bacteriocin from Lactococcus garvieae that inhibits septum formation in L. garvieae strains. Appl. Environ. Microbiol. 2013, 79, 4336–4346. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  32. Ovchinnikov, K.V.; Chi, H.; Mehmeti, I.; Holo, H.; Nes, I.F.; Diep, D.B. Novel Group of Leaderless Multipeptide Bacteriocins from Gram-Positive Bacteria. Appl. Environ. Microbiol. 2016, 82, 5216–5224. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  33. Tymoszewska, A.; Diep, D.B.; Aleksandrzak-Piekarczyk, T. The extracellular loop of Man-PTS subunit IID is responsible for the sensitivity of Lactococcus garvieae to garvicins A, B and C. Sci. Rep. 2018, 8, 15790. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  34. Tymoszewska, A.; Diep, D.B.; Wirtek, P.; Aleksandrzak-Piekarczyk, T. The Non-Lantibiotic Bacteriocin Garvicin Q Targets Man-PTS in a Broad Spectrum of Sensitive Bacterial Genera. Sci. Rep. 2017, 7, 8359. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  35. Francés-Cuesta, C.; Ansari, I.; Fernández-Garayzábal, J.F.; Gibello, A.; González-Candelas, F. Comparative genomics and evolutionary analysis of Lactococcus garvieae isolated from human endocarditis. Microb. Genom. 2022, 8, 000771. [Google Scholar] [CrossRef]
  36. Cotter, P.D.; Hill, C.; Ross, R.P. Bacteriocins: Developing innate immunity for food. Nat. Rev. Microbiol. 2005, 3, 777–788. [Google Scholar] [CrossRef] [PubMed]
  37. Langa, S.; Maldonado-Barragán, A.; Delgado, S.; Martín, R.; Martín, V.; Jiménez, E.; Ruíz-Barba, J.L.; Mayo, B.; Connor, R.I.; Suárez, J.E.; et al. Characterization of Lactobacillus salivarius CECT 5713, a strain isolated from human milk: From genotype to phenotype. Appl. Microbiol. Biotechnol. 2012, 94, 1279–1287. [Google Scholar] [CrossRef]
  38. Islam, M.; Abaragu, A.; Sistu, H.; Akins, R.L.; Palmer, K. Molecular characterization of vancomycin-resistant Enterococcus faecium isolates collected from the Dallas, Texas area. bioRxiv 2021, 13, 36. [Google Scholar] [CrossRef]
  39. Smits, S.H.J.; Schmitt, L.; Beis, K. Self-immunity to antibacterial peptides by ABC transporters. FEBS Lett. 2020, 594, 3920–3942. [Google Scholar] [CrossRef]
  40. Jeckelmann, J.M.; Erni, B. The mannose phosphotransferase system (Man-PTS)—Mannose transporter and receptor for bacteriocins and bacteriophages. Biochim. Biophys. Acta Biomembr. 2020, 1862, 183412. [Google Scholar] [CrossRef]
  41. Kjos, M.; Borrero, J.; Opsata, M.; Birri, D.J.; Holo, H.; Cintas, L.M.; Snipen, L.; Hernández, P.E.; Nes, I.F.; Diep, D.B. Target recognition, resistance, immunity and genome mining of class II bacteriocins from Gram-positive bacteria. Microbiology 2011, 157, 3256–3267. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  42. Li, Q.; Montalban-Lopez, M.; Kuipers, O.P. Increasing the Antimicrobial Activity of Nisin-Based Lantibiotics against Gram-Negative Pathogens. Appl. Environ. Microbiol. 2018, 84, e00052-18. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  43. Desiderato, C.K.; Sachsenmaier, S.; Ovchinnikov, K.V.; Stohr, J.; Jacksch, S.; Desef, D.N.; Crauwels, P.; Egert, M.; Diep, D.B.; Goldbeck, O.; et al. Identification of Potential Probiotics Producing Bacteriocins Active against Listeria monocytogenes by a Combination of Screening Tools. Int. J. Mol. Sci. 2021, 22, 8615. [Google Scholar] [CrossRef] [PubMed]
  44. Rodríguez, J.M.; Martínez, M.I.; Horn, N.; Dodd, H.M. Heterologous production of bacteriocins by lactic acid bacteria. Int. J. Food Microbiol. 2003, 80, 101–116. [Google Scholar] [CrossRef]
  45. Altschul, S.F.; Gish, W.; Miller, W.; Myers, E.W.; Lipman, D.J. Basic local alignment search tool. J. Mol. Biol. 1990, 215, 403–410. [Google Scholar] [CrossRef]
  46. Solovyev, V.; Salamov, A. Automatic Annotation of Microbial Genomes and Metagenomic Sequences. In Metagenomics and Its Applications in Agriculture, Biomedicine and Environmental Studies; Li, R.W., Ed.; Nova Science Publishers: New York, NY, USA, 2011; pp. 61–78. [Google Scholar]
  47. Naville, M.; Ghuillot-Gaudeffroy, A.; Marchais, A.; Gautheret, D. ARNold: A web tool for the prediction of Rho-independent transcription terminators. RNA Biol. 2011, 8, 11–13. [Google Scholar] [CrossRef] [Green Version]
  48. Corpet, F. Multiple sequence alignment with hierarchical clustering. Nucleic Acids Res. 1988, 16, 10881–11090. [Google Scholar] [CrossRef]
  49. Hennig, L. WinGene/WinPep: User-friendly software for the analysis of amino acid sequences. Biotechniques 1999, 26, 1170–1172. [Google Scholar] [CrossRef]
Ijms 23 04685 g001 550
Figure 1. Alignment of the amino acid sequences of garvicin AG1 (A) and garvicin AG2 (B) precursor peptides with their known homologs and with class IId bacteriocins that use a mannose-specific phosphotransferase system (Man-PTS) as a receptor (C). The double-glycine motifs (GG or GS) of the leader peptides are highlighted with a grey background, and the black arrow indicates the cleavage site that generates the mature peptide bacteriocins. The sequences were aligned using the Multalin interface page (http://multalin.toulouse.inra.fr/multalin/ accessed on 1 December 2021). Highly conserved residues (consensus level = 90%) are indicated in red, whereas weakly conserved residues (consensus level = 50%) are indicated in blue. Consensus symbols are: !, I or V; $, L or M; %, F or Y; #, N, D, Q, E, B or Z. NCBI reference sequences, UniProtKB/Swiss-Prot or GenBank accession numbers: Garvicin AG1, WP_225667055.1 (Lactococcus garvieae Lg-Granada, plasmid); Garvicin AG2, WP_165719065.1 (Lactococcus garvieae Lg-Granada, plasmid); Garvicin A, CCF71073.1 (Lactococcus garvieae 21881, plasmid); Garvicin Q, AEN79392.1 (Lactococcus garvieae BCC 43578, plasmid); Bacteriocin BacSJ, CAR92206.2 (Lacticaseibacillus paracasei subsp. paracasei BGSJ2-8, plasmid); Acidocin M, partial, BAB86318.1 (Lactobacillus acidophilus TK8912, plasmid); Bovicin 255, AAG29818.1 (Streptococcus sp. LRC 0255, chromosome); Garvicin B, CCF55365.1 (Lactococcus garvieae 21881, plasmid); Garvicin C, CCF55362.1 (Lactococcus garvieae 21881, plasmid); Lactococcin A, P0A313.1 (Lactococcus lactis subsp. cremoris 9B4, plasmid); Lactococcin B, P35518.1 (Lactococcus lactis subsp. cremoris 9B4, plasmid); Lactococcin Z, BAU29928.1 (Lactococcus lactis QU7, chromosome).
Figure 1. Alignment of the amino acid sequences of garvicin AG1 (A) and garvicin AG2 (B) precursor peptides with their known homologs and with class IId bacteriocins that use a mannose-specific phosphotransferase system (Man-PTS) as a receptor (C). The double-glycine motifs (GG or GS) of the leader peptides are highlighted with a grey background, and the black arrow indicates the cleavage site that generates the mature peptide bacteriocins. The sequences were aligned using the Multalin interface page (http://multalin.toulouse.inra.fr/multalin/ accessed on 1 December 2021). Highly conserved residues (consensus level = 90%) are indicated in red, whereas weakly conserved residues (consensus level = 50%) are indicated in blue. Consensus symbols are: !, I or V; $, L or M; %, F or Y; #, N, D, Q, E, B or Z. NCBI reference sequences, UniProtKB/Swiss-Prot or GenBank accession numbers: Garvicin AG1, WP_225667055.1 (Lactococcus garvieae Lg-Granada, plasmid); Garvicin AG2, WP_165719065.1 (Lactococcus garvieae Lg-Granada, plasmid); Garvicin A, CCF71073.1 (Lactococcus garvieae 21881, plasmid); Garvicin Q, AEN79392.1 (Lactococcus garvieae BCC 43578, plasmid); Bacteriocin BacSJ, CAR92206.2 (Lacticaseibacillus paracasei subsp. paracasei BGSJ2-8, plasmid); Acidocin M, partial, BAB86318.1 (Lactobacillus acidophilus TK8912, plasmid); Bovicin 255, AAG29818.1 (Streptococcus sp. LRC 0255, chromosome); Garvicin B, CCF55365.1 (Lactococcus garvieae 21881, plasmid); Garvicin C, CCF55362.1 (Lactococcus garvieae 21881, plasmid); Lactococcin A, P0A313.1 (Lactococcus lactis subsp. cremoris 9B4, plasmid); Lactococcin B, P35518.1 (Lactococcus lactis subsp. cremoris 9B4, plasmid); Lactococcin Z, BAU29928.1 (Lactococcus lactis QU7, chromosome).
Ijms 23 04685 g001
Ijms 23 04685 g002 550
Figure 2. Schematic representation of a 3.1-kpb DNA fragment from plasmid pLG50 of L. garvieae Lg-Granada that contains the genes encoding garvicins AG1 (orf46) and AG2 (orf48) and their corresponding immunity proteins, orf47 and orf49, respectively (A); detailed analysis of predicted promoters and Rho-independent terminator (B); and inverted repeats sequences of the IS1216 transposase (C). (A) P1 and P2 are putative promoter sequences, whereas T1 is a putative Rho-independent transcription terminator. IRR and IRL correspond to the right and left inverted repeat sequences flanking the transposase of IS1216, respectively. Resolvase indicates the orf encoding a putative transposon gamma–delta resolvase gene. (B) The putative promoters P1 and P2 were detected with Softberry BProm. The typical −35 and −10 boxes and the ribosome binding sites (RBS) are shown; “Met” in the P1 and P2 sequences indicates the methionine residues of GarAG1 and AG2, respectively. “Stop” in the P2 sequence indicates the termination codon of orf46. ARNold was used to predict the Rho-independent terminator (T1); base pairs of the hairpin are shown in blue boldface, and apical loops are indicated by red italics. The predicted free energy of terminator hairpins (kcal/mol) is given in parentheses. (C) The 22 bp right and left inverted repeats (IRR and IRL, respectively) of IS1216 showed 100% identity in their nucleotide sequence.
Figure 2. Schematic representation of a 3.1-kpb DNA fragment from plasmid pLG50 of L. garvieae Lg-Granada that contains the genes encoding garvicins AG1 (orf46) and AG2 (orf48) and their corresponding immunity proteins, orf47 and orf49, respectively (A); detailed analysis of predicted promoters and Rho-independent terminator (B); and inverted repeats sequences of the IS1216 transposase (C). (A) P1 and P2 are putative promoter sequences, whereas T1 is a putative Rho-independent transcription terminator. IRR and IRL correspond to the right and left inverted repeat sequences flanking the transposase of IS1216, respectively. Resolvase indicates the orf encoding a putative transposon gamma–delta resolvase gene. (B) The putative promoters P1 and P2 were detected with Softberry BProm. The typical −35 and −10 boxes and the ribosome binding sites (RBS) are shown; “Met” in the P1 and P2 sequences indicates the methionine residues of GarAG1 and AG2, respectively. “Stop” in the P2 sequence indicates the termination codon of orf46. ARNold was used to predict the Rho-independent terminator (T1); base pairs of the hairpin are shown in blue boldface, and apical loops are indicated by red italics. The predicted free energy of terminator hairpins (kcal/mol) is given in parentheses. (C) The 22 bp right and left inverted repeats (IRR and IRL, respectively) of IS1216 showed 100% identity in their nucleotide sequence.
Ijms 23 04685 g002
Table
Table 1. Antimicrobial spectrum of garvicins AG1 and AG2, as well as the mannose-fermenting ability of the indicator strains.
Table 1. Antimicrobial spectrum of garvicins AG1 and AG2, as well as the mannose-fermenting ability of the indicator strains.
Indicator Strain OriginSource 1Inhibition (mm) 2 by:Man 3
Garvicin AG1Garvicin AG2
Aerococcus viridans CECT 978T 4Air sampleCECT−−−
Bacillus cereus CECT 5050TUnknownCECT−−−
Carnobacterium maltaromaticum 02/5685 Fish (trout)FVM-S−18+
Enterococcus faecalis MP48 Human (vagina)FVM-N−13+
E. faecalis EIPOHuman (urine)FVM-N−18+
E. faecalis OEA1Human (urine)FVM-N−20+
Escherichia coli CECT 515THuman (urine)CECT−−+
Lactococcus garvieae 19Human (urine)HPM1216+
L. garvieae 21881 (GarA+) 5Human (blood)HRV−−+
L. garvieae 21881-N (GarA−) 6Human (blood)FVM-S−−+
L. garvieae 3AA7Food (cheese)IPLA1214+
L. garvieae 57Fish (trout)VISAVET1218+
L. garvieae 65Fish (trout)VISAVET1616+
L. garvieae 80Fish (trout)VISAVET1417+
L. garvieae 85Fish (trout)VISAVET1012+
L. garvieae 8831Fish (trout)VISAVET1418+
L. garvieae BM06/00349Human (blood)HRV1222+
L. garvieae CAS-2Food (cheese)IPLA1415+
L. garvieae CECT 4531TBovineCECT1418+
L. garvieae CP-1Fish (trout)FVM-S1014+
L. garvieae Lg-Granada Human (blood)HVN1316+
L. garvieae Lg-Granada 240-88 Human (blood)HVN1220+
L. garvieae N-201 Food (cheese)IPLA1018+
L. garvieae NRTC 0607 Food (vegetable)HUJ920+
L. garvieae T2-17 FoodIPLA1218+
Lactococcus lactis subsp. lactis MG1363 FoodIFR(QI)−19+
L. lactis subsp. lactis MP29Food (cheese)FVM-N−29+
Listeria ivanovii CECT 913TOvineCECT−24+
Listeria monocytogenes 51112FoodFVM-S−25+
Pediococcus acidilactici CECT 98FoodCECT14−−
Salmonella enterica S79Poultry (faeces)FVM-S−−+
Staphylococcus aureus CECT 86THuman (pleural fluid)CECT−−+
Streptococcus agalactiae MP007Human (vagina)FVM-N−−−
Streptococcus parauberis CCUG 39954TBovine (mastitis)CCUG−−−
Streptococcus salivarius CECT 805T Human (blood)CECT−10+
Streptococcus uberis CECT 994TBovine (mastitis)CECT−−−
1 CECT, Colección Española de Cultivos Tipo (Universidad de Valencia, Burjasot, Spain); CCUG, culture collection of the University of Gothenburg (University of Göteborg, Sweden); FVM-N, Department of Nutrition and Food Science, Facultad de Veterinaria, Universidad Complutense (Madrid, Spain); FVM-S, Departamento de Sanidad Animal, Facultad de Veterinaria, Universidad Complutense (Madrid, Spain); HPM, Hospital Puerta del Mar (Cádiz, Spain); HVN, Hospital Virgen de las Nieves (Granada, Spain); IPLA, Instituto de Productos Lácteos de Asturias (Villaviciosa, Spain); HUJ, Hiroshima University Japan (Japan); HRV, Hospital Royo Villanova (Zaragoza, Spain); IFR (QI), Institute of Food Research (Quadram Institute) (Norwich, United Kingdom); VISAVET, Centro de Vigilancia Sanitaria (Madrid, Spain). 2 Diameter of the halo of inhibition (mm). −, no inhibition. Antimicrobial activity was determined by the agar diffusion test using sterile disks impregnated with 2.5 μg of the tested bacteriocin. 3 Ability to ferment mannose. −, no fermentation; +, fermentation. 4 “T”, type strain. 5 Produces garvicin A (GarA+). 6 Derivative of L. garvieae 21881 lacking the plasmid pGL5 that encodes garvicin A; does not produce garvicin A (GarA−).
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations.

Share and Cite

MDPI and ACS Style

Maldonado-Barragán, A.; Alegría-Carrasco, E.; Blanco, M.d.M.; Vela, A.I.; Fernández-Garayzábal, J.F.; Rodríguez, J.M.; Gibello, A. Garvicins AG1 and AG2: Two Novel Class IId Bacteriocins of Lactococcus garvieae Lg-Granada. Int. J. Mol. Sci. 2022, 23, 4685. https://doi.org/10.3390/ijms23094685

AMA Style

Maldonado-Barragán A, Alegría-Carrasco E, Blanco MdM, Vela AI, Fernández-Garayzábal JF, Rodríguez JM, Gibello A. Garvicins AG1 and AG2: Two Novel Class IId Bacteriocins of Lactococcus garvieae Lg-Granada. International Journal of Molecular Sciences. 2022; 23(9):4685. https://doi.org/10.3390/ijms23094685

Chicago/Turabian Style

Maldonado-Barragán, Antonio, Estíbaliz Alegría-Carrasco, María del Mar Blanco, Ana Isabel Vela, José Francisco Fernández-Garayzábal, Juan Miguel Rodríguez, and Alicia Gibello. 2022. "Garvicins AG1 and AG2: Two Novel Class IId Bacteriocins of Lactococcus garvieae Lg-Granada" International Journal of Molecular Sciences 23, no. 9: 4685. https://doi.org/10.3390/ijms23094685

APA Style

Maldonado-Barragán, A., Alegría-Carrasco, E., Blanco, M. d. M., Vela, A. I., Fernández-Garayzábal, J. F., Rodríguez, J. M., & Gibello, A. (2022). Garvicins AG1 and AG2: Two Novel Class IId Bacteriocins of Lactococcus garvieae Lg-Granada. International Journal of Molecular Sciences, 23(9), 4685. https://doi.org/10.3390/ijms23094685

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop